Home

Thecus N4200PRO

image

Contents

1. E System Management E System Network 4 Storage aa User and Group Authentication a Application Server a Modul management BR Backup Menu Bar Item X q BDesciption amp System Information Current system status of the Thecus IP storage System Management Various Thecus IP storage system settings and information System Network Information and settings for network connections as well as various services of the Thecus IP storage Storage Information and settings for storage devices installed into the Thecus IP storage User and Group Authentication Allows configuration of users and groups Application Server Printer Server and iTunes Server to set up of the Thecus IP storage Module Management System and user Module to install of the Thecus IP storage Category of Backup Features set up of the Thecus IP storage Moving your cursor over any of these items will display the dropdown menu selections for each group In the following sections you will find detailed explanations of each function and how to configure your Thecus IP storage 39 Message Bar You can get information about system status quickly by moving mouse over Message Bar Mem status Description O 131 RAID Information Display the status of created RAID volume Click to go to RAID information page as short cut Disks Information Display the
2. Please use 4K block sve whie more than ZTB capacity wil be configured in Windows XP Please use 512 Bytes block sre for application lke VMware etc 2 Modify your setting Press ok to change Expand Volume The iSCSI volume is now able to expand its capacity from unused space From the volume list simply select the iSCSI volume you like to expand and click the Expand button Space Allocation RAID Information Master RAM Disks Total Data iSCSI ID Status RAID Level Used Capacity Capacity Capacity RAID n Healthy 1 2 219 8 0 2 GB 84 8 GB 36 9 GB Volume Allocation List iSCSITarget i5CSI Thin Privision Target Advance Option r E Qaa Mody GExpasd Delete Type Name Capacity BC iscsi 56 9 GB You will then see the dialog box displayed below Drag the Expand Capacity bar to the size you want Then press Expand to confirm the operation 78 Space Allocation Expand 15 CSI Thin Privizion Volume Name iscsi Unused 34 74 38 GB Expand Capacity Description 74 38 GB The SCSI services will be stoped during ISCST expand execution please be noticed Delete Volume To delete volume on the current RAID volume follow the steps below 1 Under the Volume Allocation List click Delete n screen appears The Space Allocatio d Sys gm nomenen Space Allocation r Dorf Mana ement RAI
3. 1 1 1 0 1 HDD Power LED e Solid blue hard disk is powered on 2 HDD e Blinking green system is accessing data on the hard disk Access Error LED e Use the lock to physically secure the hard disk to the unit 4 Latch e Use to open and remove or close and secure the tray 5 Handle e Pull out HDD tray N4200 series N5500 Each of the N5500 s hard disk trays has a lock a latch and two LED indicators Hard Disk E Description 1 HDD Power LED e Solid blue hard disk is powered on 2 HDD e Blinking green system is accessing data on the hard disk Access Error LED e Use the lock to physically secure the hard disk to the unit 4 Handle e Pull out HDD tray 16 NO503 The N0503 supports both 2 5 and 3 5 Serial ATA SATA hard disks To install a hard disk into the N0503 follow the steps below 1 Open front door of the NO503 2 For 3 5 HDD a Get the hard drive rails and install them to your SATA hard disk s b Slide hard disks into the NO503 until they snap into place c Replace the thumbscrews 3 For 2 5 HDD a It has come with 2 5 HDD cage b Remove the 2 5 HDD tray c Install HDD into d Slide 2 5 HDD cage back in till it snap into place 4 Replace the N0503 front cover Rear Panel NO503 The N0503 rear panel features ports and connectors eSATA Port USB Port 17 Back Panel e eSATA port for high speed storage expansion USB disks and USB printers switch or router e L
4. 6 Press the Apply button and the user is created ge Thecus Creator In Storage m Local User Setting Group List User Name Search User ID 1002 GroupID Group Name 73 i 140 System Management Password i tS E System Network Confirm E Password i 1 fs storage Group Members aen User end Group Autt im Greupp Group hans PADS 0 i aha 1 Users E L cc t User P Eva sm a LU ei Batch In ut 7 Application Server A a Module managemen i NOTE All users are automatically assigned to the users group Edit Users 1 Select an existing user from the Local User Configuration screen 2 Click on the Edit button and Local User Setting screen appears 3 From here you can enter a new password and re enter to confirm or use the lt lt or gt gt buttons to have this user join or leave a group Click the Apply button to save your changes 103 Edit En Local Uzer Setting Group List User Name t Search User ID GrovpID Group Name Password IIDIDIIIIIII Confirm Password HITIIIIIIITIT Group Member GrovpID Group Name 102 BEETS Remove Users 1 Select an existing user from the Local User Configuration screen 2 Click on Remove button and the user is deleted from the system Local User Configuration jx Add qo Edit Remove User ID User Name 1007 User Local User Setting xL 9 Do you want to delete this user m j Heolavine tom
5. non standard port Storage Management The Storage menu displays the status of storage devices installed in the Thecus IP storage and includes storage configuration options such as RAID and disk settings folder configuration space allocation and ISO Mount Disks Information From the Storage menu choose the Disks item and the Disks Information screen appears From here you can see various items about installed SATA hard disks Blank lines indicate that a SATA hard disk is not currently installed in that particular disk slot e The screen shot below just example from Thecus IP Storage The disk slots can from 4 to 8 depend on the model of Thecus IP storage Menu LH System Information Disks Information 4 System Management D amp k Na Capacity MB Model Frrriare Bad Block Scan B System Network i 1 907 728 WOC WD2002FYPS D 04 0 S Click to start f 2 1 907 725 WDE WO2002F P5 0 p4 b Oik to start 1 Storage 3 1 907 729 WOC WD202FYPS 0 04 0 b ick to start 4 1 907 729 WOC VWDUJ2F YP 5 0 p4 u b Cik to Sart GE Space Allocation 5 WDC WO2002F PS 0 04 0 B OK Po Cick to start fd share hara 5 WHOL VeDUWI2FTPS U 4 0 P Click to start Stackable eg ER ps ISO Mount 7 907 72 WOC WD20 42F YPS 0 04 0 b Click to start D2002FYP5 0 94 0 b ick to start 8 agn User and Group Authentication i Applicaton Server gr Modus management Disk Power Management P up T 61 Disks Information em J Descrip
6. Select a service provider to host your W eb site If you do not have a membership account one will be created for you Service providers MSN Groups Share your files with others or store them for your personal use ne N8800 Photo Gallery N8800 8800 Photo Gallery Vizard 9 Login into Thecus IP storage with your local user name and password Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS Please input ID and Password ID Password Welcome to Thecus Thecus Technology Corp 10 Create your album by entering an album name and clicking on the Create Album button 126 Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS Service On Gallery Please Select Album To f Upload PESE Album name Welcome to Thecus Create Album Thecus Technology Corp 11 Select the album you want to upload your pictures to 12 Confirm the target album Web Publishing Wizard N8800 Photo Gallery Wizard Powered by THECUS The selected Album is user album Are you sure publish photos into the Album Welcome to Thecus Thecus Technology Corp 13 Windows will show you that the picture upload is in progress Web Publishing Wizard Please wait while your files are copied File Winter ipa File progress 100 complete Currently copying file 4 of 4 To stop copyi
7. Thecus N0503 N4200 series N5500 1U4600 N7700 series N8800 series User s Manual Copyright and Trademark Notice Thecus and other names of Thecus products are registered trademarks of Thecus Technology Corp Microsoft Windows and the Windows logo are registered trademarks of Microsoft Corporation Apple iTunes and Apple OS X are registered trademarks of Apple Computers Inc All other trademarks and brand names are the property of their respective owners Specifications are subject to change without notice Copyright 2011 Thecus Technology Corporation All rights reserved About This Manual All information in this manual has been carefully verified to ensure its correctness In case of an error please provide us with your feedback Thecus Technology Corporation reserves the right to modify the contents of this manual without notice Product name Thecus N0503 N4200 series N5500 1U4600 N7700 series N8800 series Manual Version 5 1 Release Date May 2011 Limited Warranty Thecus Technology Corporation guarantees all components of Thecus NAS products are thoroughly tested before they leave the factory and should function normally under general usage In case of any system malfunctions Thecus Technology Corporation and its local representatives and dealers are responsible for repair without cost to the customer if the product fails within the warranty period and under normal usage Thecus Technology Corporation is not res
8. Apply to reboot the system now f Administrator Password Agniy To perform a file system check click Apply Once clicked the following prompt will appear File System Check xl 2 The setting has been changed carry on with press Yes for confirmation Click Yes to reboot the system bh i ii File System Check File System Check Reboot Reboot p I lr Once the system has rebooted you will be returned to the File System Check prompt There you will see the available RAID volumes to run the file system check on except ZFS volume ZFS has no need to perform file system check Check the desired RAID volumes and click Next to proceed with the file system check Click Reboot to reboot without running the check File System Check ZFS is not need file svstem check 7 RAID Level Disks Status Filesystem Status Data Capacity Last Check Time RAIDS Healthy Normal 0 2 GB 41 8 GB 51 Thecus com File System Check ZFS is not need file svstem check c Time Once you click Next you will see the following screen EETNNN Status Press Startta Begin Latest 20 lines Information Result al Click Start to begin the file system check Click Reboot to reboot the system When the file system check is run the system will show 20 lines of information until it is complete Once complete the re
9. Select the block size with 4K while the iSCSI volume size is over 2TB iSCSI CRC Checksum To enable this option the initiator can connect with Data digest and Header digest enabled CAC Checksum Data digest Header digest Share Folder From the Storage menu choose Share Folder and the Folder screen appears This screen allows you to create and configure folders on the Thecus IP storage volume I Menu Bi My fvonte m System Information Folder Se System Management wa qo gg Log Lop 2 gt System Network FoMer nama RAD ID rie System Publ escrip A neun RAD met n sync ea Storage LJ usbhdt RAE d D bh ay Deri Ca RADD C usbeom JAD akiz 0 bong Im nag ans E FAD ax 3 T anual zig fal Share Fold E andre Piel 5 p rM EN UM n atcarEaDieg I amp D Mount aan User and Group Authenticabon NT i E anntrarinn Canar 84 Adding Folders On the Folder screen press the Add button and the Add Folder screen appears This screen allows you to add a folder After entering the information press Apply to create new folder i System Information x System Management stem Network Ed Storage Dees eS RAID HE Space Allocation fal Share Fe a mi r i E FR P F m 8 8 8 der Stackable S150 Mount aa User and Group Authenticaton rm i znnkcarin tanar u gt add folder x RAID ID RAID Folder name Description Brovseable Yes No Public 7 Y
10. Share Limit Enter the maximum size of the folder The folder will not grow beyond this limit You can enter a 0 to turn off the share folder limit Remove Folders To remove a folder press the Remove button from the specified folder row The system will confirm folder deletion Press Yes to delete the folder permanently or No to go back to the folder list Folder Add Edit NFS Ga Snapshot 23 ACL Folder name gt gt RAID ID File System Public Description nsvnc RAIDI ext3 no nsync usbhdd RAIDI ext3 no usbhdd _J usbcopy RAIDI ext3 no usbcopy naswebsite RAIDJ ext3 yes naswebsite L iTunes music RAIDI ext3 yes iTunes music J BONNY RAIDI ext3 yes X de Info x The setting has been changed carry on with press Yes for confirmation i l No 86 All the data stored in the folder will be deleted once the folder is deleted WARNING The data will not be recoverable NFS Share To allow NFS access to the share folder enable the NFS Service and then set up hosts with access rights by clicking Add Config NFS share x Mount point raid data nzync amp Q Edt Remove Host Name Privilege OS Support ID Mapping Mount point raid data nzync Host Name XXX XXX XXX XXX Privilege Read Only Q Writable OS Support Unix Linux System AIX Allow source port gt 1024 ID Mappine Guest system root account will have full access
11. The system configuration you have backup can be only restore in same firmware version And the backup details have excluded user group accounts Factory default From the menu choose the Factory Default item and the Reset to Factory Default screen appears Press Apply to reset Thecus IP storage to factory default settings My vonie UE System Information i Reset To Factory Default pd System Man agement a ER SNMP UE a E uti f i A ministracor Password WARNING Resetting to factory defaults will not erase the data stored in the hard disks but WILL revert all the settings to the factory default values Reboot amp Shutdown From the menu choose Reboot amp Shutdown item and the Shutdown Reboot System screen appears Press Reboot to restart the system or Shutdown to turn the system off 50 JH System Information Shutdown Reboot System Se system Management E LE 2 s SNMP Ll f xAunminigtraror Passend ae WON Mgrre File System check The File System Check allows you to perform a check on the integrity of your disks file system Under the menu click File system Check and the File System Check prompt appears Menu B 6 My favorite UB Syste m Information f File System Check 4 cysten Management Filesystem Check has been Enable successfully The system needs to reboot to make the changes effective ER SNMP zs Encrypt raid is not support file system check 3 8l jey Press
12. download the iSCSI Initiator from the Microsoft website http www microsoft com You can find this software by entering iSCSI Initiator into the search box on their homepage 2 Once the download is complete install the iSCSI Initiator by double clicking the EXE file You may be presented with the following security warning Click Run to continue Open File Security Warning Do you want to run this file Name Initiator 2 04 build3273 x86fre exe Publisher Microsoft Corporation Type Application From U JohniisCsi Cancel potentially harm your computer Only run software from publishers y While files from the Internet can be useful this file type can you trust What s the risk 3 You will now install the iSCSI Initiator using the Setup Wizard Click Next to continue Software Update Installation Wizard Use this wizard to install the following software update Microsoft iSCSI Initiator Before you install this update we recommend that you Back up your system Close all open programs You might need to restart your computer after you complete this update To continue click Next Software Update Installation Wizard Microsoft iSCSI Initiator Installation Microsoft iSCSI Initiator will be installed Installation Options 7 i M Software Initiator pa r lt Back Cancel 5 Read the license agreement To continue with the installation click I Agree and then click Next
13. manage user access using different group policies From the User and Group Authentication menu you can create modify and delete users and assign them to groups that you designate ADS NT Support If you have a Windows Active Directory Server ADS or Windows NT server to handle the domain security in your network you can simply enable the ADS NT support feature the Thecus IP storage will connect with the ADS NT server and get all the information of the domain users and groups automatically From the Accounts menu choose Authentication item and the ADS NT Support screen appears You can to change any of these items and press Apply to confirm your settings 100 My favorite M System Information i ADSINT Support Se System Management Work Group Domain Name MYGROUP ig System Network ADSINT Support Enable amp amp Disable E J Se aye Authentication Method aa User and Group Authentication ADSINT Server Hame i ADS NT Realm 3 8 Local i l Y User Adrminitratcor ID z Group Administrator Password T Batch Input mem X Application Server j A description of each item follows ADS NT Support tem Description 1 Name MYGROUP Directory Server or Windows NT Windows NT ADS NT Server Name Specifies the ADS NT server name e g adservername ADS NT Realm Specifies the ADS NT realm e g example com Administrator ID Enter the admin
14. y Item Description this option is enabled The port number is default 80 Support option is enabled NOTE e Disable HTTP support and Enable Secure HTTP support to guarantee secure access UPnP This device supports UPnP Media server which allows users to play media files with UPnP client ex DMA devices Enable or disable Universal Plug and Play protocol UPnP helps to find the IP address of Thecus IP storage E System Information i UPnP y 4 system Management UPnP E System Network Description M NFS FTP A Media Server zal Web Disk 59 Nsync Target From the System Network menu choose the Nsync Target item and the Nsync Setting screen appears Enable or Disable your Nsync Target Server Press Apply to confirm your settings If the Thecus Nsync feature has chose to use Rsync to replicate data between two systems For the target side to allow source cross data the Rsync target server needs to assign a username and password for authentication Once Nsync Target has been enabled the other Thecus NAS product is able to operate remote replication to this NAS system vstem Information i Nsync Setting ystem Management Nsync Target Server Rsync Target Server C Enable i Disable sername Password Bonjour Setting Bonjour is Apple Inc s trade name for its implementation of Zeroconf a service discovery protocol B
15. 133 Software Update Installation Wizard License Agreement Please read the following license agreement To continue with setup you must accept the agreement END USER LICENSE AGREEMENT FOR MICROSOFT SOFTWARE Microsoft iSCSI Initiator 2 0 IMPORTANT PLEASE READ THIS END USER LICENSE AGREEMENT EULA CAREFULLY BY INSTALLING COPYING OR OTHERWISE USING THE SOFTWARE THAT 3 C Do Not Agree Print lt Back Cancel 6 The iSCSI Initiator will now install automatically Click Finish once completed Software Update Installation Wizard Completing the Microsoft iSCSI Initiator Installation Wizard You have successfully completed the iscsi200 Setup Wizard To close this wizard click Finish 7 Start the iSCSI Initiator by double clicking its icon on the desktop The iSCSI Initiator properties window will appear Microsoft iSCSI Initiator 8 Select the Discovery tab Under Target Portals click Add iSCSI Initiator Properties Target Portals Address Part Adapter IP Addr ISNS Servers Name 9 Enter the IP address of Thecus IP storage Click OK 134 Add Target Portal Type the IP address or DNS name and socket number of the portal you want to add Click Advanced to select specific settings For the discovery session to the portal IP address or DNS name Port MICE OK IAA GO 3260 10 On the iSCSI Initiator Properties window select the Targets tab
16. 2009 03 25 13 16 08 5300 dualll The system n5500 dual 1 found UPS is unavailable 2009 03 25 13 12 28 5300 duai0l User admin logged in from 172 16 65 107 2008 05 25 13 LL03 3300 dualt1 The svstem n3300 duall found UPS is unavailable See the following table for a detailed description of each item System Logs Item Description 1 1 O messages and error messages Truncate All Log File Clear all log files The number of lines per Specify desired number of lines to display per page page Sort Ascending Shows logs by date in ascending order Sort Descending Shows logs by date in descending order lt lt lt gt gt gt Use the forward gt gt gt and backward lt lt lt buttons to browse the log pages rv On line Register From the System Information menu choose the On line Register item and the System On line Register screen appears The on line register service can periodically update the user when new firmware and software modules are released by Thecus To enable this service simply check the Enable check box By enabling this service the items in bold will be sent to Thecus via the Internet 43 Menu E System Information Registration option S info Enable status The following information will be recorded after Enable checked i gs Product Model Name Current FW version Mac address of WAN Mail address of system notification on ine Reg
17. 2D09 10 14 15 Ez 0z You have reu macun IP Carm 1 0 57 2009 10 14 15 01 51 You have mew maculis IP Carn 1 0 56 angg 10 3 JSH TAL You have nee macula IP fern 1 0 55 2005 10 14 15 13 10 You have res madue IP Carm 1 0 54 2009 10 15 15 1 3 03 You have mew mocule IP 20 1 0 53 System Management The System Management menu gives you a wealth of settings that you can use to configure your Thecus IP storage system administration functions You can set up system time system notifications and even upgrade firmware from this menu Time Setting system time From the time menu choose the Time item and the Time screen appears Set the desired Date Time and Time Zone You can also elect to synchronize the system time on Thecus IP storage with an NTP Network Time Protocol Server 44 d System Information Setting system time Date 07202010 O E Time 18 2 X Time Zone Asia Tapu x A Frmware Upgrade z z t7 Schedule On Off Act as NTP 3 Enable w Disable Pigs tle Server Ma ups a Wake Up on LAN Sync with im Yes tick isc org ali con external NTP T iai STAMP server etl Be E Syste m fetvvork i Storage agn User and Group Authentication See the following table for a detailed description of each item Time Item Description o Select Disable to close the NTP server synchronization Server server of your choice Press A
18. Folders BE Desktop E fae 4 amp Public j Computer Network Control Panel Z Additional Opt By Appearance ar 59 Clock Languar S Ease of Access i Hardware and ej AutoPlay a Personalizati w Power Optio Name Documents Status v Comments Location Model Microsoft XPS Document x Writer View Sort By Group By Stack By Refresh Paste Paste Shortcut Undo Copy Run as administrator Add Printer Server Properties 3 Select Add a network wireless or Bluetooth printer 109 Choose a local or network printer Add a local printer Use this option only if you don t have a USB printer Windows automatically installs USB printers when you plug them in le Adds a i networic wien or Bluetooth Diner Make sure that your computer is connected to the network or that your Bluetooth ij orwireless printer is turned on i Searching for available printers You can press The printer that I want isn t listed to go into next page without waiting for Searching for available printers to finish 5 Click Select a shared printer by name Find a printer by name or TCP IP address Browse for a printer Select a shared printer by name http Thecus NAS IP 631 printers usb printer Example computername printername or http computername printers printername printer Add a printer using a TCP IP address or hostname Type http lt Thecus NAS gt 631 p
19. LAN2 LAN2 Configuration The Thecus IP storage supports two Gigabit Ethernet ports for higher service availability To configure these ports choose LAN2 from the System Network menu and the LAN2 Configuration screen appears Press Apply to save your changes Mf System Infomation l M System Management MAC Address DO 14 FD 10 DA 21 Arbo Frame Drisgole Support IP 192 168 2254 Netmask 255 255 255 0 Gateway Link Detected Link Speed a edia Server SS HTTE Web Disk 8 erp E hnc Target DHCP Server Configuration Fur mee Gees TFTP xis Sat Start IP 192168 2 1 End IP 1921622100 DNS Server 172 15 66 245 ABP aa lse and Group Authentication 54 LAN2 Configuration Item J Description IP Specifies the Network Mask of the LAN2 interface Gateway When Thecus NAS as a DHCP server from LAN 2 it can have another route to balance traffic bandwidth for its DHCP clients Specifies the LAN2 port link status Specifies the LAN2 port link speed Before enabling Jumbo Frame Support please make sure your network equipment supports Jumbo Frame If your equipment is incompatible you might not be able to connect to your Thecus IP storage If the IP sharing mode setting is set to Enable under WAN LAN21 port then this 2 gateway cannot be configured DHCP Server Configuration A DHCP server can be
20. Load Balance Fail over Balance XOR 802 3ad Balance TLB Balance ALB Set IP Address by You can choose a static IP or Dynamic IP and input your network M Dynamic configuration IP P IP address of the WAN LAN1 interface of the IP address of the WAN LAN1 interface interface PRSE ee mask which is generally 255 255 255 0 Default Gateway IP address DNS Server Domain Name Service DNS server IP address 53 Only use Jumbo Frame settings when operating in a Gigabit environment where all other clients have Jumbo Frame Setting enabled e Enabling DHCP automatically turns on UPnP see the Service Support Screen e If you are only using the WAN LAN1 port we suggest that you disable IP Sharing Mode This will result in higher throughput e A correct DNS setting is vital to networks services such as SMTP and NTP e To use the Link Aggregation with 802 3ad selected feature please make sure the networking equipment on the other end of Ethernet cable also supports 802 3ad protocol Most Fast Ethernet 10 100 Switches Routers do not support Jumbo Frame and you will not WARNING be able to connect to your N8800 after Jumbo Frame is turned on If this happens turn off the N8800 Then insert USB disk with factory reset utility included and power on the N8800 Till the system power on complete then it will bring your system settings back to factory default
21. Network Access with settings have been completed P 172 16 66 186 BRE AE RR RBA ICAM AH CO O B fs ipex m HED E 172 16 66 166 Sle w No Stack Target v Ej 2 rs Tf 2 sues HALEN ERAS LASEK EN Airset UBER TEA gi RTINT LM d BEDERA U ee zt C Bulb C cami LU usbcopy 4 Video Test Ribs at Thecus q ism G Bizi Cy Sx C REFIN 172 16 66 186 BALD 172 16 66 186 SD wem LoS ensetietontuR 24 3 Seles BRDO RHO MR RBA IR HAH a Or O UP be Fr stack target with export Ee Sis Tit Q semis ORALES 0 EAR LASEK 2 AEs Uw ABEER iio gy TRLLD FSRHBENE am PADRES UPnP Ey BY i ideo Test L tps Ribs gt Thecus FRAT ESAS Ej Bi y ARASH Oy MRSE share name pmmeeting caml The Browseable setting will be same method of setting for system share folder It designates whether or not this folder will be visible through web disk You may refer the figures below for reference when Yes and No are selected 94 Add iSCSI Target Add Stack Target x Enable i8CSI Target 7 Enable Disable stackable Target IP 172 16 65 157 jan iqn 2009 05 com thecus XF S iscsi vg iscsi x Username Password Export share name Limit 0 9 a2 Description The Public setting will be set same as what the setting for the system share folder associated with the ACL permission setup If Public i
22. Network menu choose the iTunes item and the iTunes Configuration screen appears You may enable or disable the iTunes Service from here Once enabled enter correct information for each field and press Apply to save your changes Menu Gy d Sem Inranmataen r r iTunes Configuration X System Management iTunes 5 Enable Diable a R es BE system Network Server Harne ly a Storage Password am User and Group Authentication Rescan Interval x z MP3 Tag Encode w 3 Applicaton Server al p Printer Apply See the following table for detailed descriptions of each field iTunes Configuration Item J Description o ID3 tags will be sent out in UTF 8 format Once the iTunes service is enabled Thecus IP storage will make all music located in the Music folder available for iTunes equipped computers on the network 112 Module Management Module Installation From the Module Management menu choose the Module Installation item and the Module Management screen appears From here you can install separate software modules to extend the functionality of your Thecus IP storage System Information T PARI Boek Dani P Imm EmA A system Informatie Mogu Fie Cfkepath Red Replication Tod SI Eutall x System Management d Module Management LEG ba j j j E System Network Enable Name Verson Descriptian Acton Elson i No IP Cam 2 0 1 IP Cam k x
23. PROF RP Sad 41 LOG S ptacbpxalciu DB ux IM LM VEL MIA IM EMI 42 On JdneiRediStel covusmcun Muss boc aec qi tos Wc he Meat Pb aa ec nit WE Ur 43 System Management 1 i esioies esses aa aaa MAN SEU ERE UEM MEE 44 Tires Seting System UME a dcccaierenneset ub pgs EAEE TRY M ONDUESUN 44 Notification Configuration sssisscos pedore CE darle tere eo ahs 45 FErmware Upgrade sedent saa i petaau am rr istic tease Jae n DU Eee 46 WPS SCURO 32s EE 46 Schedule POWER ON7 OTT sisse casui atat hv ern aum PEE REPE ERESEMV ERR n ER EV ELE Sus 47 Wake Up OM AN WOL j siia vasis Using EE SEM eM End 48 SNMP SupDOLboscusssusruesu M esum teu E LIE UI ien EubutasE a d al 49 UUM t ET ER a E ale ears ta 49 System NetWOFK isse ukk RE va VERRE RRREVRWRREEREREREKEREREREEIVVERENGVXIROECER ERRRRRE RKRRRE 53 WAND EAD osse ea sua MUI M ac MC D aL M DI PD AME 53 Bx reco rr 54 DHCP Server Configuratio esie veas oa ia aa DO Up REO e HC ERAR UA Ra 55 Samia A ECTETUR TUTIMTMM 55 AFP Apple Network Set 5siocios sae E E RARE RIPE SDRPoxPVP MA M aE 57 icc reU eine 58 RCEP VV CO DISK eT E T 59 Bun eee CE IE 59 Midas er TP 60 BOMMOU SCURG resna EE 60 ded scenes E T E E E UE 60 Storage ManagGeMe Nis scciisssetirescciccccscesccscisaccscaasecstecteesdasascsessinibencsnasee 61 DISKS Til OR Mie UON cocorico sents eesevolessecooeaensauaeee 61 RALD Infor matos seal aA A aE 63 Space AIOCdtlobus dei PEPLHdRPIPEERIXPATVTRQETU PERI Dada d PETS PET manatee ates 75 ISCSI Thilis
24. RAID is created See Chapter 6 Tips and Tricks gt Adding a Spare Disk for details For more information on RAID see Appendix B RAID Basics RAID Level You can set the storage volume as JBOD RAID O RAID 1 RAID 5 RAID 6 or RAID 10 RAID configuration is usually required only when you first set up the device A brief description of each RAID setting follows RAID Levels requires a minimum of 1 disk but not data safety RAID O requires a minimum of 2 disks Offers disk mirroring Provides twice the read rate of single disks but same write rate RAID 1 requires a minimum of 2 disks RAID 5 Data striping and stripe error correction information provided RAID 5 requires a minimum of 3 disks RAID 5 can sustain one failed disk RAID 6 Two independent parity computations must be used in order to provide protection against double disk failure Two different algorithms are employed to achieve this purpose RAID 6 requires a minimum of 4 disks RAID 6 can sustain two failed disks RAID 10 RAID 10 has high reliability and high performance RAID 10 is implemented as a striped array whose segments are RAID 1 arrays It has the fault tolerance of RAID 1 and the performance of RAID O RAID 10 requires 4 disks RAID 10 can sustain two failed disks If the administrator improperly removes a hard disk that should not be WARNING removed when RAID status is degraded all data will be lost 68 Edit RAID On the RAID Information s
25. To attempt to reconnect the stack target click Reconnect Stack Target List Oas QURE QRemove gt Export share name IP Capacity Uzed Total Status Description ign ici 172 1665 157 0GB 0 1GB Disable ign 2009 05 cor zi p Rann ar TE dit Remove P Reconnect P tatus Description ign Export share name IP Capacity Used Total sta tacsi 172 16 65 157 0 GB 0 1 GB Disable iqn 2008 05 co Success i You have successfully reconnect to the stack folder iscsi ISO Mount The ISO Mount feature is very useful tool from Thecus products With it users can mount an ISO file and having export name to display all details from mounted ISO file 97 From the main menu the ISO Mount feature is located under Storage Please refer the figure below for reference Select on the ISO mount function and you will have the screen shot appear as following Menu Gf My Evante E System Network I Mounted Path t Path O Sma Pars leti i a ion 12 motni intention ic dupl Description m Maximum 50 I50 fies can be mounted in total aa User and Group Authentication A Add a ISO file From the figure above select ISO file from drop down share list ISO Mount nsvnc usbhdd usbcopy ISO Path ISO Size naswebsite iTunes music After selection system will bring up Mount table for further setting screen 7 ISO filter Unmount 4 j naswebsite E Mounted Path ISO Path ISO S
26. Trusted list 139 Replacing Damaged Hard Drives If you are using RAID 1 RAID 5 or RAID 6 you can easily replace a damaged hard drive in the Thecus IP storage while keeping your data secure with the system s automatic data recovery Hard Drive Damage When a hard drive is damaged and data in the RAID volume the system LCD will display warning message also the system beeps Replacing a Hard Drive To replace a hard disk drive in Thecus IP storage 1 2 3 4 5 Remove the tray with the damaged hard disk N0503 is using HDD rail Unscrew the damaged hard disk and remove it from the tray Slide a new hard disk into the tray and fasten the screws Insert the hard disk tray back into Thecus IP storage until it snaps into place You can also lock it with a key if desired The LED blinks green when the HDD is accessed RAID Auto Rebuild When using RAID 1 5 6 or 10 on Thecus IP storage you can use the auto rebuild function when an error is detected 1 When a hard disk fails the system beeps and or an email notification is sent to specified receivers Check the LCD to see which disk has failed Follow the steps mentioned above to replace the failed hard disk The system automatically recognizes the new hard disk and starts the auto rebuild sequence to resume its status before the hard disk crash 140 Chapter 7 Troubleshooting Forgot My Network IP Address If you forget your network IP address and
27. With the iSCSI target highlighted click Log On The Log On to Target dialogue will appear iSCSI Initiator Properties General Discovery Targets Persistent Targets Bound Volumes Devices Select a target and click Log On to access the storage devices for that target Click details to see information about the sessions connections and devices for that target Targets Name ign 2007 05 com thecus RAID iscsi0 vg0 test Inactive 11 If you have not enabled CHAP click OK to continue Log On to Target Target name ign 2007 05 com thecus RAID iscsi vg0 test C Automatically restore this connection when the system boots Enable multi path A Only select this option if iSCSI multi path software is already installed on your computer Advanced Cancel If you have enabled CHAP click Advanced Under Advanced Settings check the CHAP login information checkbox and enter your username and password Click OK 135 Advanced Settings General PSec Connect by using Local adapter Default Source IP Default Target Portal Default CRC Checksum C Data digest C Header digest CHAP helps ensure data security by providing authentication between a target and an initiator trying to establish a connection To use it specify the same target CHAP secret that was configured on the target for this initiator User name ign 1991 05 com m
28. configured to assign IP addresses to devices connected to the LAN2 port To configure these ports choose LAN2 from the System Network menu DHCP Configuration DHCP Server Enable or disable the DHCP server to automatically assign IP Start IP End IP DNS Server Displayed the DNS server IP address NOTE The IP Segment of WAN LAN1 and LAN2 should not overlap The IP address of the LAN2 interface should not be in the range of the WARNING Start IP address and End IP address Samba CIFS There are 5 options is currently allow Admin to Enable Disable to operate Thecus IP storage associated with Samba CIFS protocol With the option changed it will need to reboot system to activate 55 d Sytem Information X system Management Samba Service amp Enable CI Diable li a C je ir Het ark h L M any pills amp Enable C3 Disable Enable Disanle LJ Enable im Deeg dhe Samoa is Hative Mode Yas Matwe Mode C3 Har Comnatihle Mode T UHTX Extensions Enable C Dae aan User and Group Authenticabon Samba Service Used for letting the operating system of UNIX series and SMB CIFS of Microsoft Windows operating system Server Message Block Common Internet File System Do the link in network protocol Enable or Disable SMB CIFS protocol for Windows Apple Unix drive mapping NOTE File Access Cache File Access Cache is default Enable This option will help to increase the performance whil
29. detailed description of each item 42 n Eanetenrt Tefsen i t ge 5 D YS DHT IO Sretem Loge IAM mM Ln LX Error L Download All Log File Truncate All Log File The somber of lines per pare 13 Logs Informati 2305713 16 22 30 TIGU The wtem TT os recovering the RAID and rebalding is in progres 2002 23 13 33 18 SUDO Dui en STD hx baa added 009 0513 15 39 46 TOO Dia 5 oe 77040 fuas beet added 200900513 15 3943 TTDO Disk 2 on 2587700 has been added 2D60005 12 14 08 38 TOO Laer admin fogged in irem 172 15 85 123 2002305713 13 45 03 TOO Lar nimia logged in eei 172 15 53 155 2009 015 13 11 11 45 TIO User admin fogged in from 172 16 65 172 2009505713 09 59 19 TTUU Veer admin fogged in from 172 165 565 138 2002 03 13 09 41 36 1160 Caer admin 2aggad in frers 172 15 63 538 2005 05 13 9 37 40 TICO Usar admis dogged in Srom 172 15 55 1 3E 2007 01 07 02 35 01 TTOO Leer admin logged in irum 172 15 66 78 IDOL UI 02 34 26 TTOD Lever admin fogged in irom 172 05 66 35 007 0102 0235 06 7700 NT TOO Bee T Page El m Tasplaving logs l 13 of 15 Time 2009 05 25 13 44 31 2000 05 25 13 41 29 2000 05 25 13 364 available available vailable 2009 05 25 13 26 18 3 The syste y Logs Information B unavailable 2009 05 25 13 21 13 5500 dual0 The svstem n5500 dual0T found UPS is unavailable
30. free program will individually obtain patent licenses in effect making the program proprietary To prevent this we have made it clear that any patent must be licensed for everyone s free use or not licensed at all The precise terms and conditions for copying distribution and modification follow TERMS AND CONDITIONS FOR COPYING DISTRIBUTION AND MODIFICATION O This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License The Program below refers to any such program or work and a work based on the Program means either the Program or any derivative work under copyright law that is to say a work containing the Program or a portion of it either verbatim or with modifications and or translated into another Language Hereinafter translation is included without limitation in the term modification Each licensee is addressed as you Activities other than copying distribution and modification are not covered by this License they are outside its scope The act of running the Program is not restricted and the output from the Program is covered only if its contents constitute a work based on the Program independent of having been made by running the Program Whether that is true depends on what the Program does 1 You may copy and distribute verbatim copies of the Program s source code as you receive it in any
31. have no physical access to the system you can find out the IP address by either looking directly onto Thecus IP storage LCD panel or by using the setup wizard to retrieve the IP of your Thecus IP storage 1 Start the Setup Wizard and it will automatically detect all Thecus IP storage products on your network 2 You should be able to find the IP address of Thecus IP storage which you have forgotten in the Device Discovery screen Can t Map a Network Drive in Windows XP You may have problems mapping a network drive under the following conditions 1 The network folder is currently mapped using a different user name and password To connect using a different user name and password first disconnect any existing mappings to this network share 2 The mapped network drive could not be created because the following error has occurred Multiple connections to a server or shared resource by the same user using more than one user name are not allowed Disconnect all previous connections to the server or shared resource and try again To check out existing network connections type net use under the DOS prompt You may refer the URL below for more network mapping information http esupport thecus com support index php mzdownloads amp azviewdownload amp downloaditemid 57 amp nav 0 Restoring Factory Defaults From the System menu choose the Factory Default item and the Reset to Factory Default screen appears Press Apply to reset
32. medium provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty keep intact all the notices that refer to this License and to the absence of any warranty and give any other recipients of the Program a copy of this License along with the Program You may charge a fee for the physical act of transferring a copy and you may at your option offer warranty protection in exchange for a fee 2 You may modify your copy or copies of the Program or any portion of it thus forming a work based on the Program and copy and distribute such modifications or work under the terms of Section 1 above provided that you also meet all of these conditions a You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change b You must cause any work that you distribute or publish that in whole or in part contains or is derived from the Program or any part thereof to be licensed as a whole at no charge to all third parties under the terms of this License C If the modified program normally reads commands interactively when run you must cause it when started running for such interactive use in the most ordinary way to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty or else saying that you provide a warranty and that users may redistribute the program under
33. network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N0503 2 Connect the provided power cord into the power socket on the back panel Plug the other end of the cord into a surge protector socket 23 3 Open the front door then press the power button boot up the N0503 CA d mm mu EE n mss Rn 5 7 cee Ello Y m J aa HNN D A gt Sin NEED F i d wl ra O m mum ao eeu E hi 4 l ach D emm To connect the N4200 series product to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N4200 lt POS 9 e 49 6 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protector socket 3 Press the power button on the Front Panel to boot up the N4200 24 To connect the N5500 to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N5500 2 Connectthe provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protector socket Press the power supply switch to turn on the power supply Oe To connect the 1U4600 to your network follow the steps below 1 Connect an Ethernet c
34. of parity is calculated and written across all the drives RAID 6 provides for an extremely high data fault tolerance and can sustain two simultaneous drive failures This is a perfect solution for mission critical applications RAID 10 RAID 10 is implemented as a striped array whose segments are RAID 1 arrays RAID 10 has the same fault tolerance as RAID level 1 RAID 10 has the same overhead for fault tolerance as mirroring alone High I O rates are achieved by striping RAID 1 segments Under certain circumstances RAID 10 array can sustain up to 2 simultaneous drive failures Excellent solution for applications that would have otherwise gone with RAID 1 but need an additional performance boost JBOD Although a concatenation of disks also called JBOD or Just a Bunch of Disks is not one of the numbered RAID levels it is a popular method for combining multiple physical disk drives into a single virtual one As the name implies disks are merely concatenated together end to beginning so they appear to be a single large disk As the data on JBOD is not protected one drive failure could result total data loss Stripe Size The length of the data segments being written across multiple hard disks Data is written in stripes across the multiple hard disks of a RAID Since multiple disks are accessed at the same time disk striping enhances performance The stripes can vary in size 145 Disk Usage When all disks are of the same
35. or disk Document The available documentation of module Action To install module or deleted p s If module list from on line then no delete option available Rescan Click to rescan from both on line and disk Module Package modules xir f Module Source List Installed Manna Version Description Location Document Action Mot Installed IP Carn 2 0 1 IP Cam Disk Em x Mot Installed Twonkyrmadia 1 0 0 Twonkymedia Disk ji Install Mod ule on Dik Not rristalled webserver 1 0 4 Webserver Disk m After click on Action to install module the module will be under list of Module Installation Please do Enable to activate module usage System Module The system module is officially provided by Thecus for new features added The module will list once it has been enabled from Module Installation a Module management EP Module Installation Auto Module Installation c m System Module af P Cam af NZBGet Sf Raid Replication i User Module User Module The user module is reserved for Thecus fans to build up 3 party functions in the future 114 Backup There are a number of ways to back up data with the Thecus IP storage Nsync You can backup a share folder to another Thecus IP storage Nsync Target or any FTP server for safe keeping as long as you have appropriate access right on that target If the files on your Thecus IP storage are lost for any reason you can restore those files from the target Thecus IP
36. provision volume can only create 5 iSCSI target volumes The notification will send out while the physical size of iSCSI thin provision capacity has used up to 90 Advance Option There are 2 options is currently allow Admin to Enable Disable to operate Thecus IP storage associated with iSCSI setting The details as listed in following screenshot With the option changed it will need to reboot system to activate Menu Li id System Information Space Allocation b d System Management RAID Information Bi System Network t Master ip RAID etits Disks Total Data SCSI a RAID Level TUBES Used Capacity Capacity Canacky 4 storage k RAID Hazthy 1 2 3722 2 0 2 GB 3424 4 G8 37 2 GB a Des ES RAID sa RAID Volume Allocation List HE Space Adocation Ed Share Fodder SCSI Target SCSI Thin Prowsion Targed Advance Option SD Stackable 2 180 Mount SCSI Block sre 512 Baes For older version SCSI CRC Chacksurme Disable bv Description The SC51 black see can be set under system advance option defauk b 512 Bytes Please usa 3K block sze while mare than 278 capacity wil be configured in Windows XP Please usa 512 Bytes black size for application ike VMware ete 83 5 pace Allocation X 9 The setting has been changed carry on with press Yes for confirmation No Space Allocation X i iSCSI block size have setting success iSCSI Block Size
37. respectively Next click Format to proceed with formatting After the format is complete the stack target volume will be created successfully You will see the volume s capacity and status in the Stack Target List screen C Edit a Stack Target To make any changes to stack targets click Edit for the corresponding stack target and system will bring up the following dialogue Edit iSCSI Target X Enable iSCSI Target Enable Disable Stackable Target IP ign Lisername Password ee ee Limit 0 9 a z Description Browseable Q9 yes 7 no Public Qai no Apply After your changes have been made click Apply to confirm any modifications Once changes are applied the associated information will be updated on the Stack Target List window D Stack Target ACL If the stack target Public setting set to Yes then the ACL button will be grayed out However if Public setting is set to No then the ACL button will be available for you to setup user access permissions for the stack target 96 ACL settings will be exactly the same as system folder that you may have setup previously ACL TRE x Recursive Deny Read Only Writable Local Groups v JP Search x Name Name Name Name users E Reconnect a Stack Target The enabled stack target devices may be disconnected by situations such as power outages or network disconnects When this happens the Reconnect button will available
38. single power connector Power Connector Power Switch USB Ports A Type LAN2 Port System Fan eSATA Port Serial Port USB Ports B Type WAN LAN1 Port 21 N8800 series The N8800 rear panel features ports and connectors N8800PRO SP is Single power UC I A E Ju See EHEHEEHENHENENRE ann LJ m EEEHEHEHNEHHEHNEENMEE a ne M D m gE M LLL H mum EEHREENE pte Jugo NE Seuss ee eee 1 BEEEEEEEEEZEN Back Panel Itm Description 4 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 5 Serial Port e This port is for external UPS device switch or router switch or router 22 Chapter 2 Hardware Installation Overview Your Thecus IP storage is designed for easy installation To help you get started the following chapter will help you quickly get your Thecus IP storage up and running Please read it carefully to prevent damaging your unit during installation Before You Begin Before you begin be sure to take the following precautions 1 Read and understand the Safety Warnings outlined in the beginning of the manual 2 If possible wear an anti static wrist strap during installation to prevent static discharge from damaging the sensitive electronic components on the N8800 3 Be careful not to use magnetized screwdrivers around the Thecus IP storage s electronic components Cable Connections To connect the N0503 to your
39. size and used in RAID Thecus IP storage disk usage percentage is listed below RAID 6 n 2 n x 100 RAID 1 JBOD 100 n HDD number 146 Appendix C Active Directory Basics Overview With Windows 2000 Microsoft introduced Active Directory ADS which is a large database information store Prior to Active Directory the Windows OS could not store additional information in its domain database Active Directory also solved the problem of locating resources which previously relied on Network Neighborhood and was slow Managing users and groups were among other issues Active Directory solved What is Active Directory Active Directory was built as a scalable extensible directory service that was designed to meet corporate needs A repository for storing user information accounts passwords printers computers network information and other data Microsoft calls Active Directory a namespace where names can be resolved ADS Benefits ADS lets Thecus IP storage integrate itself with the existing ADS in an office environment This means the Thecus IP storage is able to recognize your office users and passwords on the ADS server Other major benefits ADS support provides include 1 Easy integration of Thecus IP storage into the existing office IT infrastructure The Thecus IP storage acts as a member of the ADS This feature significantly lowers the overhead of the system administrator For example corporate security polic
40. status of disks installed in the system Click to go to Disk information page as short cut FAN Display system FAN Status Click to go to Fr System Status page as short cut A Network Green Connection to network is normal T Red abnormal connection to the network Logout l Click to logout Web Administration Interface Language Selection The Thecus IP storage supports multiple Languages including e English Language e Japanese e Traditional Chinese e Simplified Chinese si IE pz e French Hha e German L auti e Italian deis e Korean Deutsch e Spanish talano e Russia zation korean e Polish Spanish e Portugal Russia On the menu bar click Language and the selection list poish appears This user interface will switch to selected Perbonil Language for Thecus IP storage 40 System Information Information provides viewing on current Product info System Status Service Status and Logs The menu bar allows you to see various aspects of the Thecus IP storage From here you can discover the status of the Thecus IP storage and also other details Product Information Once you login you will first see the basic Product Information screen providing Manufacturer Product No Firmware Version and System Up Time information d System Information Product Information W ino 5 Manufacturer Thecus A Status E Logs Product Ha N7700 On ine Register F
41. storage To backup files regularly you can set up a scheduled task to run only once daily weekly or monthly You can also limit the bandwidth of your Nsync tasks so other users on the network can share the bandwidth equally Under the Backup menu click Nsync and the Nsync window appears Menu TO My favorite M E iH System Information Hsync Systeam Management Add Edit m Restore Del in System Network L Task name Semer Snare Folder Last Time Last Status Schedule Acton 4 storage av Bandwidth Setting M aa User and Group Authentication 0 Application Server a Modul management Item Description O Click to add a Nsync task Click to Edit an Nsync task Restore share folder from an Nsync target S Click to delete an Nsync task Backup files on Nsync target is also deleted Task name Action Administrator can run or stop an Nsync task by pressing the action button Bandwidth Setting Bandwidth control on Nsync tasks Add Nsync Task From the Nsync screen click Add to display the Add Nsync Task screen 115 Add Nsync Task Tage name Target Server Manufacturer m HAS Co Legacy FTP Seregi OO Natie Rene Sere Nsync Made i Synchronize Compare source and target then delete unaxist files C Inzremental Copy fle fram source to target Target Server IP address Share Folder nsswebsite i Authorged Usemame an Target Sener Password on
42. the RAID storage space as JBOD RAID O RAID 1 RAID 5 RAID 6 or RAID 10 see Appendix B RAID Basics for a detailed description of each 3 Specify a RAID ID 4 Ifthis RAID volume is meant to be the Master RAID volume tick the Master RAID checkbox In a multiple RAID configuration one RAID volume must be designated as the Master RAID volume The Master RAID volume will store all installed modules If the Master RAID is changed to another location i e assigning volume 2 to be the Master RAID volume after volume 1 had been previously assigned then all modules must be reinstalled In addition all system folders that were contained on the Master RAID volume will be invisible Reassigning this volume to be the Master RAID will make these folders visible again 5 Selected whether the RAID volume will be encrypted or not The RAID volume can protect data by using RAID Volume Encryption function to prevent the risk of data exposure To activate this function the Encryption option needs to be enabled while the RAID is created and followed by password input for identification Also an external writable USB disk plugged into any USB port on the system is required to save the password you have entered while the RAID volume is being created See the screenshot below for details RAID Information r Create RAID Disk Ma Capacity MB Model Status Used Spare l 1 907 729 WDC WO2002 OK E E 5 2 1 907 729 WDCYJ D2
43. the register file 124 File Download 5ecurity Warning Do you want to run or save this file Mame xPPublish reg Type Registration Entries 377 bytes From 172 16 65 158 While files fram the Internet can be useful this file type can potentially harm your computer IF vou da nat trust the source do nat run or save this software What s the risk Once the register file is installed use the Windows file manager to browse the folder that contains the picture you want to publish On the left pane there will be an icon labeled Publish this folder to the Web File Edit view Favorites Tools Help Q Back gt B as Searcl h lg Folders EJ s My Pi Web Publishing Wizard E Welcome to the Web Publishing Wizard This wizard will help you publish your files over the Internet or a local network so that other people can view them in their Web browsers To continue click Next Cancel Select the pictures you want to publish to the Photo Web Server by placing a check mark on the top left hand corner of the picture Click Next 125 Wok SITISE ERE TES E E izai Chaves loui Ede Selecion Fog cages nie has His hah haee Check vente HE pou do nol meer lo publuh afl plea PI check bos 7 Your PC will start to connect to the Photo Web Server 8 Select Thecus IP storage Photo Gallery Wizard to publish your pictures to Thecus IP storage Web Publishing Wizard Where do you want to publish these files
44. then the folder management screen with Snap button will be configurable Snapshot List for nzync 01172 16 66 39 znapshot X Snapshot Schedule o Take Shot 9 Remove Snapshot Date Snapshot Take Shot Click to take snapshot right away Click to remove snapshot schedule Schedule Click to open snapshot schedule setup screen Clicking on schedule button then schedule setup screen appear Checked the enable check box to activate the snapshot scheduled operation 88 Snapshot List for navne 1172 16 66 39 2napchor X Snapshot Schedule Enabled Snapshot Schedule _ Automatically remove oldest snapshot Schedule Rule Monthly Day 0 Hour The Thecus IP storage snapshot is supported total 16 versions Once checked Automatically remove oldest snapshot the oldest will be removed to let newest to added on top Otherwise if the check box is unchecked and snapshot versions are up to 16 then system will appear warning message and won t execute the task till available version count The snapshot schedule rules can be setup for monthly weekly or daily Clicking on Apply after firmed with desired schedule These taken snapshot is only accessible though CIFS SMB by manually type NAS IP address snapshot and invisible from normal access Also the taken snapshot version is read only can not be deleted under CIFS SMB access but only click the Del button showing on the screen shot above
45. 002 OK C C 3 1 907 728 WDC ViD2002 Warning g r 4 1 907 728 WDC VWD2002 OK O a 3 1 807 728 WDC V D2002 OF El C 5 1 907 729 WDC WO2002 OK m r1 ba RAID Level JE Pus EEA RADI RAIDS RAE D RAIE 1E RAID 1D t Alow 079 az And Allow 1718 characters Confirm Password Quick Raid meretet made of hard disk Stripe Sge KB d Data Percentage i Fie System Mi pm Once the Create button has been pressed with the Encryption checkbox enabled the following message pop up will appear for confirmation 65 RAID Configuration x To encrypt RAID volume will cause performance down and you need to have writable USB disk insert to USB port te store encrypted password Strongly recommend to backup your encrypted password to somewhere alse safely or the password lose will cause date unreacheble After the RAID volume has been created you may remove this USB disk until the next time the system boots The RAID volume can not be mounted if the USB disk with key can not be found in any system USB port when the volume is accessed To activate the encrypted volume plug the USB disk containing the encryption key and into any system USB port We are strongly recommended copying the RAID volume encryption key to a Safe place You can find the encryption key file from the USB disk in the following format RAID volume created date xxxxxx key Please keep USB disk in a safe place and also backup the encrypted ke
46. 150 these conditions and telling the user how to view a copy of this License Exception if the Program itself is interactive but does not normally print such an announcement your work based on the Program is not required to print an announcement These requirements apply to the modified work as a whole If identifiable sections of that work are not derived from the Program and can be reasonably considered independent and separate works in themselves then this License and its terms do not apply to those sections when you distribute them as separate works But when you distribute the same sections as part of a whole which is a work based on the Program the distribution of the whole must be on the terms of this License whose permissions for other licensees extend to the entire whole and thus to each and every part regardless of who wrote it Thus it is not the intent of this section to claim rights or contest your rights to work written entirely by you rather the intent is to exercise the right to control the distribution of derivative or collective works based on the Program In addition mere aggregation of another work not based on the Program with the Program or with a work based on the Program on a volume of a storage or distribution medium does not bring the other work under the scope of this License You may copy and distribute the Program or a work based on it under Section 2 in object code or executable form under the t
47. ACERO 120 Chapter 5 Using Thecus IP Storage 121 OVGEVICW eco 121 Login Page ica iion dr ROC IGI IEPAO UR Gn Cw a a a a C E RR KO RR GR RR 121 Using WebDISICi oiii aa vveoVE pxFWE VENE UE QUE aa UE QUPD MEER KR 121 Photo Servel issixidu a iaEwawENAVRRANENSKULULEITEREXIUEREN E au aXRR ARMED RULERREROE RR ER URN 123 Windows XP Publishing Wizard eeeeeeee nnn 124 Managing Albums and Photos cernens 129 Creating AlDUIMS eds uk ada rincet ER WORK ER VIRES Rad dLVa Pad XRVA ERY KORR EDI EE RIT TS 130 Password Protecting Albums cceeeeeeeeen nnne 130 Uploading Pictures to Albums een nnn 130 EXIF IN fOn Mia UON caaea onere vbi atat A sae Eua curte Faro careless 131 Slide SNOWS rieren aiam SR wo RR RA REFER aya Fimad oYa xA RENESKIANI FERE A REDE PNE RES 131 Mapping a Client PC to the Thecus IP Storage 132 MALICIO WIS oss dax Maus quce oSE Cr LUE a e dose attori tato Ldanedt s venseana nies 132 ADDICOS ere 132 Mapping Thecus IP storage as an iSCSI Drive 132 Windgdows 2000 XP vicina ie linus ets epI E Dto bimotulelotca e rr Pete a 133 WIDdOWS VISE sx Pra RARE EeE E REDE ERU E DIR RARO Ea RARE Ee EYE EOKER UE DIE PAR Pd 137 Chapter Gt Tips ANG TICKS iiic ERROR OG SER RO RO ROC RCRERC C n 138 USB and eSATA Storage Expansion nennen enun nnno hh hh hau 138 Adding a Spare DI
48. AID 6 HDDx4 to RAID 6 HDDx8 RAID 6 HDDx5 to RAID 6 HDDx6 RAID 6 HDDx5 to RAID 6 HDDx7 RAID 6 HDDx5 to RAID 6 HDDx8 RAID 6 HDDx6 to RAID 6 HDDx7 RAID 6 HDDx6 to RAID 6 HDDx8 RAID 6 HDDx7 to RAID 6 HDDx8 74 Space Allocation iSCSI Target You may specify the space allocated for iSCSI or target USB volumes target USB is available in model N5500 and 1U4600 The iSCSI volume can be created from 5 to 25 volumes per system depend on Thecus IP storage s model Model N0503 N4200 N5500 N7700PRO series 1U4600 N7700SAS N8800PRO N8800SAS Allow iSCSI volume To do this under the Storage menu click RAID and the RAID List window appears Select the RAID volume you wish to reallocate by clicking on its radio button and click Space Allocation The RAID Information and Volume Allocation List windows will appear The Volume Allocation List displays the space allocated for iSCSI volumes on the current RAID volume A System Information Space Allocation r4 Cece Management i RAID Information ig System Network Master qn RAD au Disks Total Data SCSI _ RAID d Lewel TT Used Capacty Capacity Canary storage RAID D Heath 1 2 3722 2 D 26B 34244 GH 37 2 GB Volume Allocation List iSCSI Target ESI Tino Target Advance Ontian us Mau Gi Add qModfy Expand Gq Delete Tyne Name Capacity aa User and Group Authentication j SCSI EEOgara 1 37 2 GB 3H Apolcation Server mr Module managem
49. AN2 port that can be used for connection sharing e System fan that exhausts heat from the unit e Connect the included power cords to these connectors e Resets the N0503 e Immediately press and hold the Reset button on the back for 5 seconds This will reset your network setting password and turn off Jumbo Frame Support N4200 series The N4200 rear panel features ports and connectors Power Connector USB Ports 8E eSATA Ports Bd wan Port LAN Port Back Panel Item Description e For connect the power adaptor WAN LAN1 Port e WAN LAN1 port for connecting to an Ethernet network through a switch or router LAN2 Port e LAN2 port for connecting to an Ethernet network through a switch or router USB Ports T e USB 2 0 ports for storage expansion eSATA Ports e eSATA port for high speed storage expansion 18 N5500 The N5500 rear panel features ports and connectors I E y 0008 as Qe f TIL 4 5 Back Panel 1 WAN LAN1 Port e WAN LAN1 port for connecting to an Ethernet network through a switch or router 2 LAN2 Port e LAN2 port for connecting to an Ethernet network through a switch or router 3 Serial Port e This port is for external UPS device 4 eSATA Port e eSATA port for high speed storage expansion 5 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 6 System Fan e System fan that exhau
50. B Volume Allocation List T MM MS f iSCSI Target iSCSI Thin Privision Target Advance Option iSCSI Thin Privizion Volume Qaa Type Name Capacity Next setup the physical capacity for iSCSI thin provision volume by dragging the Allocation bar to the desired size Space Allocation X Create 15 C 5I Thin Privizion Volume RAID ID RAID Unused 28 61 28 GB Allocation 21 9 GB After the size has been determined click OK to confirm Now you will see the iSCSI thin provisioning volume is available from the list Please refer to the screenshot below 80 Space Allocation RAID Information Master ID RAID S Disks Total Data 1SCSI RAID Level B Used Capacity Capacity Capacity RAID 0 Healthy 12 219 8 0 2 GB 84 8 GB 91 9 GB Volume Allocation List iSCSI Target iSCSI Thin Privizion Target Advance ption iSCSI Thin Privizion Volume ds Expand o Delete iSCSI Thin Privizion lt Ada 72 Lun Type Name Capacity YE Now you can start to create iSCSI targets to join the newly created iSCSI thin provision volume Basically the iSCSI target under iSCSI thin provisioning has exactly same settings screen as the standard iSCSI target volume creation The only difference is the Virtual Size of capacity Unlike creating standard iSCSI target volumes the capacity has been physically allocated The iSCSI target volume creation under thin provisioning can virtual
51. Backup Utility exe to a convenient location on your hard disk and double click to execute it If you can not find Thecus Backup Utility on your CD please download it from the Thecus website http www thecus com When you execute this utility for the first time it will ask you whether to create a DB file Click Yes 1 Click Add to create a Backup task The Add New Task dialog box appears Add New Task Item Description 1 O If unchecked the backup will be a full backup Excluded extensions Files with these file name extensions will be skipped and not back up to the destination Comments If you wish enter comments here for your records 2 To schedule the task to run at regular intervals click on the Schedule icon for that task You can schedule the task to run Monthly or Weekly 3 To check the log for that task click on the Log icon for that task Thecus Backup Utility also supports MAC OS X Just copy the Thecus Backup Utility dmg to your MAC OS X machine and double click to execute it 119 Windows XP Data Backup If you use Windows XP Professional you can also use the Windows Backup Utility Ntbackup exe to backup your files If you use Windows XP Home Edition follow these steps to install the utility 1 4 5 Insert the Windows XP CD into a drive and double click the CD icon in My Computer When the Welcome to Microsoft Windows XP screen appears click Perform Addit
52. Button W 11 Enter Button 12 Escape Button ESC 13 LCD Display 14 HDD Trays e Blinking orange system is being upgraded or system startup data currently inaccessible e Solid green network link e Blinking green network activity e Solid green network link e Blinking green network activity e Solid blue System is power on e Push to enter LCD operate password for basic system setting e Push to leave the current LCD menu e Displays current system status and warning messages e Five 3 5 SATA HDD trays e Locks are provided for added security 12 N7700 Series The Thecus N7700 series front panel has the device s controls indicators and hard disk trays 14 a i E dep Deb ik 1 E N OOBODM B es NM M NM M MI M IN MINI ese EM NM MV IM MIX E NNI II LI OLX EE MN DIM NM M M EE EE ENIM B EL M E ooo 2 4 NEM EM OM OM XO eebo ooo ooo AM NN NEM Nl 66 MM MIX EE MM NM LL M MOI OE I LI OU EIE OM E ELE OE LN M B E MON I BM OL eee E EM EE MEE LL EE IEEE IE XN NM M Io NM A NE MN M LEE MX ee E E EE E OE M M ee M M MEM LL LAE o eee LJ EE EM EM E E OL ee M M ee M M M M M E EM EE LJA M EE E EN ees LAN LA o C M E E E ees LJA RE UE E EN LAN EE E M AM M LJ E 2 ees ee o ee LJA A 2 LJ o Thecus vali C2 LIN NN EN Jj A v wm ESC 9 1011 12 Front Panel Description e Solid blue System is power on e Solid orange system is being upgraded or system startup data cur
53. C m ae d RR ERR RR RICH RC ewan 144 Benefits uoa Cua noavxS dE ELI we M OUS eque deese ded sad ap ME HE INED CER ER 144 Improved Pertortmidli6Qussslessaataddac e Face epar dnce dud d duca cad RR M Pu Buc 144 Data SECCU er P P J dere 144 RAID Levelsicixivisiniexn xa Gn C C DER KG RR DOC GC C ER CC CORR QU CER D 144 Appendix C Active Directory Basics eer eeee rn 147 OVerVIQG W wsssstruerFaERQa ViRSN NM I EMEN FRI E EN EN RSAREASE ERNEEEEEENMAMEPIF E DEEERSMN ESSE 147 What is Active Directory scc ax an ncc c ROC SCCIDGIORCO sannana naaraana 147 ADS BenellEs i caes bun enda Ra i Ra Rb Ec hn eio el dead X a c cr rrrrerrrer rer er errr 147 Appendix D Licensing Information eere 148 OVER VIC W METTE TT NT 148 Source Code Availability eeeeeeeeeeee 148 CGIC License Ternis us escena aeria saos a RC ROI AOI R RC AER EROR EROR RR RR ACC PR ORE 149 GNU General Public License eeeeeeeeee 149 Chapter 1 Introduction Overview Thank you for choosing the Thecus IP Storage Server The Thecus IP storage is an easy to use storage server that allows a dedicated approach to storing and distributing data on a network Data reliability is ensured with RAID features that provide data security and recovery over multiple Terabyte of storage are available using RAID 5
54. D Information r Wi 3l i gal ly f p System Metwark Master oy RAID disp Disks Tota Data SCSI E 1 peii RAID Level Jsaed Capacty Capacity Capacity chai E RAID 0 Hezit 1 2 3722 2 D 2GB 24244 GH 37 2 GB af Disks E RAD Lind Volume Allocation List al Space Alocat fad Share Folder iSCSI Target GCS Thin Froveion Target Advance Option e ET SSA AE ENE Stackable 150 Mount qe Add eModfy pjExpen gy Delete Tyne Name Capacity aan User and Group Authentication BCSI Epidprogi 37 2 GB 8i Applicaton Server a Module management Space Allocation x 3 2 Press YES All data All data in the volume will be removed as well Are you sure No in the volume will be removed ISCSI Thin Provisioning With this function the iSCSI capacity can be more flexible and more efficiently serve more users The idea for iSCSI thin provisioning is sharing the available physical capacity to a number of iSCSI target volumes and also setup virtual capacity to expand the physical size while it needed To setup iSCSI thin provisioning go to Space Allocation under the Storage category The iSCSI thin provisioning volume needs to be created first Simply click iSCSI Thin Provision Target You can refer the screen shot below 79 Space Allocation RAID Information Master RAID z Disks Total Data iSCSI ID Status x a RAID Level Used Capacity Capacity Capacity RAID 0 Healthy 1 2 219 8 0 2 GB 84 8 GB 70 G
55. DDNS Setting from your Home PC Click on Yes for Enable the DDNS Client Select www dyndns org Go to router setup screen and enter the following information User Name or E mail Address xxx example com Password or DDNS Key xxxx Host Name www N8800 dyndns org Enable wildcard Select Yes Update Manually Click Update i Eh o coco Part Ill Setting up Virtual Servers HTTPS 1 Navigate to NAT Setting gt Virtual Server 2 For Enable Virtual Server select Yes 3 Setup the HTTPS Server a Well Known Applications Select User Defined b Local IP Enter 192 168 1 100 c Port Range 443 the default HTTPS port setting on the Thecus IP storage d Protocol select TCP e Click Aad f Click Apply 4 Test the HTTPS connection from another computer on the Internet a From a remote computer open your browser and enter https www N8800 dyndns org b You should see the login page of N8800 Firewall Software Configuration If you are using a software firewall i e Norton Internet Security and are having trouble connecting to Thecus IP storage you can try the following steps 1 Double click the NIS icon on system tray and then configure the Personal Firewall 2 On the Programs page find the SetupWizard exe and change its permission to Permit All If it s not in the program list use the Add or Program Scan buttons to find it 3 On the Networking page manually add N8800 IP address i e 192 168 1 100 to the
56. DDx5 to RAID 0 HDDx6 RAID 1 HDDx5 to RAID 0 HDDx7 RAID 1 HDDx5 to RAID 0 HDDx8 RAID 1 HDDx6 to RAID 0 HDDx7 OFFLINE RAID 0 HDDx2 to RAID 5 HDDx3 RAID 0 HDDx2 to RAID 5 HDDx4 RAID 0 HDDx2 to RAID 5 HDDx5 RAID 0 HDDx2 to RAID 5 HDDx6 RAID 0 HDDx2 to RAID 5 HDDx7 RAID 0 HDDx3 to RAID 5 HDDx4 RAID 0 HDDx3 to RAID 5 HDDx5 RAID 0 HDDx3 to RAID 5 HDDx6 RAID 0 HDDx3 to RAID 5 HDDx7 RAID 0 HDDx3 to RAID 5 HDDx8 RAID 0 HDDx4 to RAID 5 HDDx5 RAID 0 HDDx4 to RAID 5 HDDx6 RAID 0 HDDx4 to RAID 5 HDDx7 RAID 0 HDDx4 to RAID 5 HDDx8 RAID 0 HDDx5 to RAID 5 HDDx6 RAID 0 HDDx5 to RAID 5 HDDx7 RAID 0 HDDx5 to RAID 5 HDDx8 RAID 0 HDDx6 to RAID 5 HDDx7 RAID 0 HDDx6 to RAID 5 HDDx8 RAID 0 HDDx7 to RAID 5 HDDx8 ONLINE RAID 1 HDDx2 to RAID 5 HDDx3 RAID 1 HDDx2 to RAID 5 HDDx4 RAID 1 HDDx2 to RAID 5 HDDx5 RAID 1 HDDx2 to RAID 5 HDDx6 RAID 1 HDDx2 to RAID 5 HDDx7 RAID 1 HDDx2 to RAID 5 HDDx8 RAID 1 HDDx3 to RAID 5 HDDx4 RAID 1 HDDx3 to RAID 5 HDDx5 RAID 1 HDDx3 to RAID 5 HDDx6 RAID 1 HDDx3 to RAID 5 HDDx7 RAID 1 HDDx3 to RAID 5 HDDx8 RAID 1 HDDx4 to RAID 5 HDDx5 RAID 1 HDDx4 to RAID 5 HDDx6 RAID 1 HDDx4 to RAID 5 HDDx7 RAID 1 HDDx4 to RAID 5 HDDx8 RAID 1 HDDx5 to RAID 5 HDDx6 RAID 1 HDDx5 to RAID 5 HDDx7 RAID 1 HDDx5 to RAID 5 HDDx8 RAID 1 HDDx6 to RAID 5 HDDx7 RAID 1 HDDx6 to RA
57. DOM2 is Read only initially Any circumstance occurred while DOM2 successes recover DOM1 The FW will be version of DOM2 Therefore it may need to upgrade to the version of DOMI it has If DOM1 can not be recovery from DOM2 then system will boot up from DOM2 The original configuration in DOM1 may need to setup again with DOM 2 operation 142 Appendix A Customer Support If your Thecus IP storage is not working properly we encourage you to check out Chapter 7 Troubleshooting located in this manual You can also try to ensure that you are using the latest firmware version for your Thecus IP storage Thecus is committed to providing free firmware upgrades to our customers Our newest firmware is available on our Download Center http www thecus com download php If you are still experiencing problems with your Thecus IP storage or require a Return Merchandise Authorization RMA feel free to contact technical support via our Technical Support Website http www thecus com support tech php Customers in the US should send all technical support enquiries to the US contact window included in the following web page http www thecus com support tech php For Sales Information you can e mail us at sales thecus com Thank you for choosing Thecus Thecus 143 Appendix B RAID Basics Overview A Redundant Array of Independent Disks RAID is an array of several hard disks that provide data security and high pe
58. ERERIRERERIRIRRMEIRRMNIKERIREFERERERERERR RR REREIRMES 23 Before You Begin eiikk uaa ku unu oaa RR CR RODA ER OCC CRGO GO E RC Ga E CR GR ORC UC ERR 23 Cable Connections sosceci esie i bx x gba ic ee ni Ro Pei CERO Rab Rab RR ri Rp eC 23 Chapter 3 First Time Setup e eere rennen nnn nnne 29 OVerVIe W a wensvevimavsuuutuER aa VEMM M EUM M E NM VEP MN MEDIO DM VEME CENE MMMEF USER KEEN 29 THECUS Setup Wizard ssi uiukun ani paa ODER Rr Pe OL ERG OD SER RO RE RR RR GER 29 LCD Operation N5500 1U4600 N7700 series NS8800 series 31 LCD Operation N0503 iiiiaakus ion onn Go OCoX XO OG RO GO GO GGOGCGGGOOGODOG CR n 33 OLED Operation N4200 series ee 34 Typical Setup ProcedUre wis ideas air GO nr Ww a GG KE GG GO On DR GC oni 35 Chapter 4 System Administration eee eere 37 OVervIGW ixeiskal krbRARMAWESSRIRNEMERRRRERERRRRRERRRI M MINZERVNLNMEERRREREERCRREVERIR MER NERRNIS 37 Web Administration Interface ee eeeee eee 37 MDy RaVOLlbeucecmei aiu IM I E I DIAM M C M E M QM 38 Eelefobfe eU 40 Eziniel rfe 2s euei ieee a tai ee ek oa 40 System Information ciens ia ciini acini anc RCEGCR DER ICE OR CRGO CRGO CR RERO CR CRI CR ERR ICE RR 41 Product MOnato sis sugeis sat eto ATL ESI at iU UELL IPM Ud cic d Mt D dU 41 SvVstem Service Staus pirrer rT REE Mea vM HD E E RELPIIEPBRE Mi rRCalRT
59. Folder and sub folders Access Control List ACL On the Folder screen press the ACL button and the ACL setting screen appears This screen allows you to configure access to the specific folder and sub folders for users and groups Select a user or a group from the left hand column and then choose Deny Read Only or Writable to configure their access level Press the Apply button to confirm your settings ACL setting x 9 This process maybe need sometimes to sync T Are you want sync account No 89 ACL setting x Recurzive Deny Read Only Writable Local Groups w jb Search a 2 Name Nam Name Nam users ACL setting Deny Denies access to users or groups who are displayed in this column Read Only Provides Read Only access to users or groups who are displayed in this column Writable Provides Write access to users or groups who are displayed in this column Enable to inherit the access right for all its sub folders To configure folder access follow the steps below 1 On the ACL screen all network groups and users are listed in the left hand column Select a group or user from this list With the group or user selected press one of the buttons from the three access level columns at the top The group or user then appears in that column and has that level of access to the folder Continue selecting groups and users and assigning them access levels using the column buttons To remove a gr
60. Hp HZBGet 1 0 0 HzBOet b x au User and Group Authentication e No Raid_Repication 1 0 0 Raid Volume Repacation kb x 9 Applicaton Server af Modu e management Module Inszalatian EF Auto Module instalation Bl system Module E User Module wr m Backup j amp y Auto Module Installation Or choose the Auto Module Installation item and the available system Module screen appears The default to get module list is On line so if Thecus IP storage is capable to connect to Internet then it will automatically link to Thecus official website then list available modules Please refer the screen shot below r iy favorite AE System Information Modda Package Le AM System Management Module Source List lg System Network installed Mame Verson Description Location Document Action E ta Feet g g et dn E zd Ed strage Not Installed NzBGet 1 0 0 MzEXiBt Cowra One EA 1 00 10 Maberver 1 00 10 Mal serve Oriine amp mat User and Group Authentication i Mat Irstaled IP Cam 2 0 1 Simple survedance rine amp E e pgr 1 i Application Server Mat Installed Usb eSATA Backup 1 0 1 Schedule backup ubfity 1 Online amp A 3f Modde management 1 0 0 Raid Replication 1 0 0 Duplication for created F Online amp ff Module instalation 1 0 0 Twonkymeda 1 0 0 Media server in DLNA Orting Auto Modia Iretalatian SL PTODENS Tr Et 1 0 9 CLM 10 9 HTTB FTP ET eMe do Online amp Syste
61. ID 5 HDDx8 73 RAID 6 X ONLINE RAID 1 HDDx2 to RAID 6 HDDx4 RAID 1 HDDx2 to RAID 6 HDDx5 RAID 1 HDDx2 to RAID 6 HDDx6 RAID 1 HDDx2 to RAID 6 HDDx7 RAID 1 HDDx2 to RAID 6 HDDx8 RAID 1 HDDx3 to RAID 6 HDDx4 RAID 1 HDDx3 to RAID 6 HDDx5 RAID 1 HDDx3 to RAID 6 HDDx6 RAID 1 HDDx3 to RAID 6 HDDx7 RAID 1 HDDx3 to RAID 6 HDDx8 RAID 1 HDDx4 to RAID 6 HDDx5 RAID 1 HDDx4 to RAID 6 HDDx6 RAID 1 HDDx4 to RAID 6 HDDx7 RAID 1 HDDx4 to RAID 6 HDDx8 RAID 1 HDDx5 to RAID 6 HDDx6 RAID 1 HDDx5 to RAID 6 HDDx7 RAID 1 HDDx5 to RAID 6 HDDx8 RAID 1 HDDx6 to RAID 6 HDDx7 RAID 1 HDDx6 to RAID 6 HDDx8 RAID 1 HDDx7 to RAID 6 HDDx8 RAID 1 HDDx6 to RAID 0 HDDx8 RAID 1 HDDx7 to RAID 5 HDDx8 RAID 1 HDDx7 to RAID 0 HDDx8 X ONLINE RAID 5 HDDx3 to RAID 5 HDDx4 RAID 5 HDDx3 to RAID 5 HDDx5 RAID 5 HDDx3 to RAID 5 HDDx6 RAID 5 HDDx3 to RAID 5 HDDx7 RAID 5 HDDx3 to RAID 5 HDDx8 RAID 5 HDDx4 to RAID 5 HDDx5 RAID 5 HDDx4 to RAID 5 HDDx6 RAID 5 HDDx4 to RAID 5 HDDx7 RAID 5 HDDx4 to RAID 5 HDDx8 RAID 5 HDDx5 to RAID 5 HDDx6 RAID 5 HDDx5 to RAID 5 HDDx7 RAID 5 HDDx5 to RAID 5 HDDx8 RAID 5 HDDx6 to RAID 5 HDDx7 RAID 5 HDDx6 to RAID 5 HDDx8 RAID 6 HDDx7 to RAID 6 HDDx8 RAID X X ONLINE 6 RAID 6 HDDx4 to RAID 6 HDDx5 RAID 6 HDDx4 to RAID 6 HDDx6 RAID 6 HDDx4 to RAID 6 HDDx7 R
62. ID 6 RAID 10 RAID ID Ram i Alow 0 9 a z Z E Master RAID Take affect after checked box Encryption 3 Password CAlowle16 characters Confirm Password Quick Raid rj Enable this setting to enhance RAID creation time f there is no partition existed inside of hard disk Stripe Size KB e x Data Percentage HS File System bd Menu E hiy vonte CH System Information RAID Information M system Management e reste dedi fan System Network z Mas p RAID ihi Disks Total Data SCSI RAID Laval ve Used Capachy Capacity Capa RAD o Formatting 1 2 3722 2 NJA N A ay Disks E RAID Elnata Aissi 3 rased Ull Space Alocation fl Share Folder Ss Stackable A I50 Mount RAID Status Formatting RAID RAID Configuration x All current active services will be stopped when RAID is being created Are you sure to create RAID now RAID Configuration Eg RAID Setting Successfully All current active services will be stopped when RAID is being created 67 Building a RAID volume may take time depending on the size of hard drives and RAID mode In general while the RAID volume building process is up to RAID Building then the data volume is capable to be accessed WARNING Creating RAID destroys all data in the current RAID volume The data is unrecoverable With a RAID 1 RAID 5 or RAID 6 volume you can also add a spare disk after the
63. IP Storage usually only the printing and fax functions will work Other features such as scanning will probably not function To set up the Printer Server in Windows Vista follow the steps below 1 Open Printer Folder from the Control Panel Ow gt Control Panel gt Control Panel Home Classic View Security e a Network and Internet Firewall a Mouse Printer System and Maintenance Get started with Windows Back up your computer Check for updates Check this computer s security status e Allow a program through Windows View network status and tasks Set up file sharing i Hardware and Sound e Play CDs or other media automatically Program Recent Tasks og wie Uninstall a program Change startup programs User Accounts and Family Safety Set up parental controls for any user A Appearance and Personalization Clock Language and Region CI Change keyboards or other input methods ij Ease of Access N Let Windows suggest settings Q9 Add or remove user accounts Change desktop background Change the color scheme Adjust screen resolution Change display language Optimize visual display Additional Options 2 Click the right mouse button in anywhere on the Printers folder and then select Add Printer QGO E Hardware and Sound Printers ews v 1 Add a printe Favonte Links IE Documents E E Pictures 7y Ready 41 Music More
64. LCD display Enter Button 1 e Push to confirm information entered into the LCD display Escape Button ESC e Push to leave the current LCD menu N4200 series The Thecus N4200series front panel has the device s controls indicators and hard disk trays OLED Panel UP Button Down Button HDD LCD Enter Button WAN LCD Escape Button LAN LCD USB LCD USB Port Power Button Front Panel Item Description Power Button e Power on off N4200series e Displays current system status and messages e OLED screen saver will be enabled after screen is left idle for more than 3 mins e OLED screen will be diabled after it is left idle for more than 6 mins e Yellow HDD activity e Red HDD failure e Yellow HDD activity e Red HDD failure e Yellow HDD activity e Red HDD failure e Yellow HDD activity e Red HDD failure e Blinking green network activity LED LAN2 LED e Blinking green network activity USB Copy e Blue USB Copy activity e Red USB Copy failure HDD Tray e Four HDD trays support 4x 3 5 or 4 x 2 5 HDDs USB Copy Button e Copy USB storage contents to NA200series USB Port e USB 2 0 port for compatible USB devices such as USB disks 11 N5500 The Thecus N5500 front panel has the device s controls indicators and hard disk trays Front Panel 1 System LED 2 WAN LAN1 LED 3 LAN2 LED 4 USB Copy LED 5 Syetem Warning LED 6 Reset Button 7 USB Port 8 Power Button Power LED 9 Up Button A 10 Down
65. Modify buttons on the top right hand corner 130 EXIF Information While viewing pictures you can also have Thecus IP storage display the EXIF information for each photo lr c Thaci Ceealor in Sianga E mm T EL Protect su scura Secure vwa Data Simply click the EXIF button to display EXIF information To hide this information click the EXIF button again Slide Shows Slide shows are a great way to enjoy pictures stored on your Thecus IP storage You can click on the Start Slide Show icon on the top right hand corner to start the slide show Thagus T cus Creator in Sragi we pere EMO oboe andy x nlibum gt Sga SCM PG Filerzunie z DISCHI IPG File Sine 73H53 bytes i rm STAI BE Ret 11559 Fiet z eet aukohale Fc beet z tt mm Exmceure Times 2 208 xr dente fh 1S 8 um WERE PEGBnes gt fut urb Metering Pick Huti Segt n Protect drm Secure Data To stop the slide show click on the Stop Slide Show icon on the top right hand corner 131 Mapping a Client PC to the Thecus IP Storage You can map share folders on Thecus IP storage so that you can access them as if they were drives on your computer You can connect to the shared network folders on Thecus IP storage as follows Windows 1 Go to the My Computer folder in Windows 2 In the menu bar select Tools and then Map Network Drive 3 The Map Network Drive window appears 4 Assign a drive letter for the share
66. P Storage series products in maximum possible combination The other model which has less HDD supported can refer web UI while RAID migration operated Below is a table listing of possible RAID migration schemes RAID 0 OFFLINE RAID 0 HDDx2 to RAID 0 HDDx3 RAID 0 HDDx2 to RAID 0 HDDx4 RAID 0 HDDx2 to RAID 0 HDDx5 RAID 0 HDDx2 to RAID 0 HDDx6 RAID 0 HDDx2 to RAID 0 HDDx7 RAID 0 HDDx3 to RAID 0 HDDx4 RAID 0 HDDx3 to RAID 0 HDDx5 RAID 0 HDDx3 to RAID 0 HDDx6 RAID 0 HDDx3 to RAID 0 HDDx7 RAID 0 HDDx3 to RAID 0 HDDx8 RAID 0 HDDx4 to RAID 0 HDDx5 RAID 0 HDDx4 to RAID 0 HDDx6 RAID 0 HDDx4 to RAID 0 HDDx7 RAID 0 HDDx4 to RAID 0 HDDx8 RAID 0 HDDx5 to RAID 0 HDDx6 RAID 0 HDDx5 to RAID 0 HDDx7 RAID 0 HDDx5 to RAID 0 HDDx8 RAID 0 HDDx6 to RAID 0 HDDx7 RAID 0 HDDx6 to RAID 0 HDDx8 RAID 0 HDDx7 to RAID 0 HDDx8 OFFLINE RAID 1 HDDx2 to RAID 0 HDDx2 RAID 1 HDDx2 to RAID 0 HDDx3 RAID 1 HDDx2 to RAID 0 HDDx4 RAID 1 HDDx2 to RAID 0 HDDx5 RAID 1 HDDx2 to RAID 0 HDDx6 RAID 1 HDDx2 to RAID 0 HDDx7 RAID 1 HDDx2 to RAID 0 HDDx8 RAID 1 HDDx3 to RAID 0 HDDx4 RAID 1 HDDx3 to RAID 0 HDDx5 RAID 1 HDDx3 to RAID 0 HDDx6 RAID 1 HDDx3 to RAID 0 HDDx7 RAID 1 HDDx3 to RAID 0 HDDx8 RAID 1 HDDx4 to RAID 0 HDDx5 RAID 1 HDDx4 to RAID 0 HDDx6 RAID 1 HDDx4 to RAID 0 HDDx7 RAID 1 HDDx4 to RAID 0 HDDx8 RAID 1 H
67. PFOVISIOPIEIG usescbp tbe E RES ES RN PEE bp EE EI CIN MEN dE E PE 79 Advance DUO Mister Sueno fuese SM UM EE HE I EM C LM EE 83 Share Role es gaat a ta edna ud dea he cal ee hie ae I e Pues Rau Mats tec EE MM 84 Folder and sub folders Access Control List ACL ccceeeeeeeeeeeeeeeeeeeeeeeees 89 Stackdbie AS raain a C DEI M PATER 92 TSO MOUN d ER 97 User and Group Authentication e eeeeeeee ene h hh nnn h noh nhan uu uuu uuu 100 ADSINT SIDDOLE25 3 22 200 8 5195699 E Se bbetes eee desee apa tact rd 100 Local User COnTIGUAUIOD sos cec aa e oec nd isa cep a oco a e DER 102 Local GEoup Gonrguletolissseses uds ss tend A p M ree cen dot 104 Batch Create Users and Groups eeeeennn nennen nennen nnn 107 Application Server si noo ono ceo o DOO ODIO OCC GC GER EGER o GO OC LEER 107 Punter TATORM cidiol Met pd EIE 107 MANES R SEVO a Cm 112 Module Management ari nsina RR ROO GER RO Oe i 113 Module IrstelldEIOEiussss0 29 b 2EPCHPUPRPLRPVERTEVIETI RIO IERI RPPCE RES RS EP Ue SUED eda 113 Auto Module Installation 52x s oopose x xim px X Id ue nons oso DopEEr ated 113 Backup siia eeeuyvasawsc uat uw cR DOO EC e acr De Rn Do OO D GC OR RR 115 INS V ING er 115 Dual DOM except NO503 N4200Eco N7700 N8800 eee eee 117 Thecus Backup UEY irrin aa a a ean 119 Windows XP Data Backup aues taa difan n a cu iU dare E ham ERR 120 Apple OS X Backup Utilities us eire cde pa RIA DER RR PE eco Qo tes AR
68. RAID Configuration lt i RAID Infomation update Successfully 69 Remove RAID Click to remove the RAID volume All user data and iSCSI has been created in selected RAID volume will be removed To remove a RAID volume follow the steps below 1 On the RAID List screen select the RAID volume by clicking on its radio button and click RAID Information to open the RAID Configuration screen 2 On the RAID Configuration screen click Remove RAID 3 The confirmation screen appear you will have to input Yes with exactly wording case to complete Remove RAID operation RAID Information Expand Morate RAID Edit Dsk Ho Capaoty MB Madel Status Used Spare 1 907 729 WOC WD2002 OK 2 i D 29 DC WO OK 3 007 729 DC WD2902 g 4 507 728 DC WD2002 Q 5 29 JC WOII OR 7 729 Woo OF RAD Level RAID D RAID 1 RAID 5 R RAID ID AID Mo GS aet And Iv Master RAID Take effect after checked box Encryption Password Alow 1716 characters Confirm Password Quick Raid Enable this setting ta enhance RAID creation tme f there s no partition existed inside of hard disk Stripe Size Ke Data Percentage Fia System v WARNING Expanding a RAID unrecoverable Remove RAID destroys all data in the current RAID volume The data is To expand a RAID 1 RAID 5 or RAID 6 volume follow the steps below 1 Replace one of the hard drives in the RAID volume and allow it to automatically rebui
69. RITING WILL ANY COPYRIGHT HOLDER OR ANY OTHER PARTY WHO MAY MODIFY AND OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE BE LIABLE TO YOU FOR DAMAGES INCLUDING ANY GENERAL SPECIAL INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES END OF TERMS AND CONDITIONS 153
70. SK xivissxasivassburtaub a3a vaa E EEEFEL ERE EREREEPER MU FERRE FEE ERR E 138 Remote AdministratiOHD aiii aiio GGG Gc GO GGG OD GG GG C GR GRO 138 Part Setupra DynDNS ACCOUD siete kr i nS ad squidiciba desi Dich is cc 139 5 Part II Enable DDNS on the Router een IH HH mmn 139 Part III Setting up Virtual Servers HTTPS eren 139 Firewall Software Configuration c eere eene n nho hh h nonna uuu 139 Replacing Damaged Hard Drives c eee eee eene n nono nnn nnno uuu 140 Hard Drive Damage a c 140 Replacing a Hard DPMesu si wees 2h aia ite ERE ER RR dE EN ed aan Ia ads 140 RAID AutosRebulldsesssss coss ts RPAPRDEERERII MEMO UU PURER CUP MERO NRDRHRVE DUREE 140 Chapter 7 Troubleshooting eere erre 141 Forgot My Network IP Address e o enne neon nnn nnn nnn nnn uuu 141 Can t Map a Network Drive in Windows XP 141 Restoring Factory Defaults oo ooo eene eene n nnn nnn nh uuu uuu u uuu 141 Problems with Time and Date Settings eere 142 Dual DOM Supports for Dual Protection eee 142 Appendix A Customer Support eere nenne 143 Appendix B RAID B SICS i svs xvYsaRYRRARERERRRRAERERNOEVEVEEEERERAERSRRAEEEE 144 OVerVIQ W uxiucsewisus au Eum wn uim V RC R
71. Target Server Test Connacton Tat Connaectioe Schedule Enable Digan Add Nsync Task Item J Description oO The name of your Nsync task Target Server Select replication to method it has 3 options can choose from Manufacturer NAS To other Thecus IP storage with security tunnel build up Legacy FTP To the 3 party FTP server or Thecus IP storage while it has acted as FTP server Native Rsync Server Using rsync to replicate data to other Thecus IP storage Nsync Mode Synchronize mode or Incremental mode Target Server IP The IP address of your target server Address Source Folder The share folder you want to backup Authorized Username The account name on the target server on Target Server Password on Target The password for the username on the target server Server Select whether to run the Nsync task daily weekly or monthly Daily input the time of day to execute Nsync task Weekly input which day of the week to execute the task Monthly decide which day of the month to execute the task Press Add to submit your settings Before starting an Nsync Task make sure the target server s Nsync Server or FTP Server is enabled Using Native Rsync Server to backup data to other Thecus NAS devices needs to enable target server and setup a valid username and password to grant access permission 116 Setting up an Nsync Target on an Thecus IP storage Nsync D
72. Target Server Enable or Disable Nsync Target support To enable Nsync task to go thru firewall you have to open port TCP 1194 on your firewall in both directions Dual DOM except N0503 N4200Eco N7700 N8800 The unique Dual DOM feature can now perform Auto Repair The Thecus NAS will backup up to five versions of the system configuration either by the default timing of 1 00am every day automatically or as scheduled by the user This unique Auto Repair will be triggered if the primary DOM has a booting issue In this instance the 2 DOM will take over the boot function Then the system will automatically load the most recent system configuration backup image to repair the primary DOM 117 Menu UH System Information x System Management ign System Network 5tnrage aai User and Group Authenticatinn G Appicaton Sever rd Mote management BE esc niam t g Dual DOM Backup Dual DOM Schedule Backup v Enable Disable Dual DOM schedule backup iB Auto Daily D Weekly C3 Monthy Dual DOR Backup Status Tasx Marre Date Frimware bacdkuo OO00001 SH10 06 05 22 00 3 04 00 3 backum OOOOD FO10 07 24 17 00 3 02 01 118 Thecus Backup Utility The Thecus Backup Utility is on your Installation CD When you click on the CD the Backup Utility will be installed under Program Groups Thecus Thecus Backup Utility If it is not installed you can copy the file Thecus
73. Thecus IP storagefactory default settings 141 Problems with Time and Date Settings The administrator is able to select an NTP Server to keep Thecus IP storage time synchronized However if Thecus IP storage can not access the Internet you may encounter a problem when setting the Time and Time Zone If this happens 1 Login to the Web Administration Interface 2 Navigate to System Management Time 3 Under NTP Server select No 4 Set the Date Time and Time Zone 5 Click Apply In addition if Thecus IP storage is able to access the Internet and you want to keep the NTP Server clock isc org by default please make sure the DNS Server is correctly entered thereby allowing the NTP Server name to correctly resolve See System Network gt WAN LAN1 gt DNS Server Dual DOM Supports for Dual Protection The most advance and useful of Thecus IP storage depend on models is Dual DOM implemented In the normal circumstance it has no need to have this feature involved But with irresistible cause like power cut or human error by accident occurred especially during system booting stage this will become the great feature to prevent system down time Practically while it happened system will try to recovery the DOM 1 from DOM 2 first If itis unachievable then system can boot from DOM 2 And all of this procedure can be operated by LCM The Dual DOM in DOM1 is default master and FW upgrading will only execute in DOM1 unlike
74. USB Copy function enables you to copy files stored on USB devices such as USB disks and digital cameras to the N8800 by press button To use USB copy follow the steps below 1 Plug your USB device into an available USB port on the Front end 2 In Display Mode press the Down Button V 3 The LCD will display USB Copy 4 Press Enter and the N8800 will start copying USB disks connected to the front USB port 5 All of data will be copied into system folder named USB copy Management Mode During setup and configuration the LCD will be in Management Mode To enter into Management Mode press Enter J and an Enter Password prompt will show on the LCD At this time the administrator has to enter the correct LCD password System will check whether the correct LCD password has been entered The default LCD password is 0000 If correct password is entered you will enter into the Management Mode menu Management Mode Item Description Exit Management Mode and return to Display Mode You can also change your LCD password using the Web Administration Interface by navigating to System Management gt Utility gt Administrator Password For more on the Web Administration Interface see Chapter 4 System Management 32 LCD Operation N0503 LCD Controls Use the Down V Up A Enter J and Escape ESC keys to operate LCD to view system information and USB copy The fol
75. WOL item and the Wake up On LAN screen appears From here you can Enable or Disable 48 Wake up On LAN Configuration Item _ Description WOL Service Enable or Disable WOL service Apply Click Apply to save changes SNMP Support From the menu choose the SNMP item and the SNMP Support screen appears You could enable the SNMP function and filled in the related information in each fields With the SNMP management software could get system basic information UH System Information SHMP Support Coc eer Management AX System Managem SNMP Service 33 Time amp Pl rotification Read Community he Firmware Upgrade System Contact ta schedule On Off System Location Pa LPs Trap Target IP LE uns n m nn ard A a aee i system Netwark From the menu choose the SNMP item and the SNMP Support screen appears From here you can Enable or Disable Utility Administrator password From the menu choose the Administrator Password item and the Change Administrator Password screen appears Enter a new password in the New Password box and confirm your new password in the Confirm Password box Press Apply to confirm password changes There is also password for enter LCD setting you could setup here Enter a new password in the New Password box and confirm your new password in the Confirm Password box Press Apply to confirm password changes Menu Ei d System In
76. a CIFS E arp Fd TP A description of each item follows NFS Server Setting Enable or Disable NFS support Apply Click Apply to save your changes 5 FTP Thecus IP storage can act as a FTP server enabling users to download and upload files with their favorite FTP programs From the System Network menu choose the FTP item and the FTP screen appears You can change any of these items and press Apply to confirm your settings Menu 8 Sytem Information FTP lt 5ustem Management x FTP i Enable C3 Diable jc eons Evark La M IERI Ferre Secure FTP c Enable im Disable E Expkck Port 21 FTF ENCODE urz s v Allow Anonymous picad Lovenicad FTP Access L a Auto Rename Uplaad Bandwidth 1s Unlmizec eR RE ee ee D wnlaad Unlimited User and Grup Autherticaton riter mat SET dna P Bandiin JH Applaton Server EF Modus management Fron C EU HELM RE A description of each item follows FTP Enable FTP Service on Thecus IP storage has also security FTP setting enabled non standard port FTP ENCODE If your FTP client or operating system does not support Unicode e g Windows 95 98 ME or MAC OS9 8 select the same encoding as your OS here in order to properly view the files and directories on the server Available options are BIG5 HZ GB2312 GB18030 ISO EUC JP SHIFT JIS and UTF 8 Allow Anonymous FTP Upload Download Allow anonymo
77. able from your network to the WAN LAN1 port on the back panel of the 1U4600 25 2 Connectthe provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protector socket Press the power supply switch to turn on the power supply If you are installing the 1U4600R be sure to connect both power cables If you do not the system will assume one power supply has failed and an alarm will sound To connect the N7700 series products to your network follow the steps below 1 Connect an Ethernet cable from your network p to the WAN LAN1 port on the back panel of T the N7700 2 Connectthe provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protector socket Press the power supply switch to turn on the power supply 26 Thecus To connect the N8800 series products to your network follow the steps below 1 Connect an Ethernet cable from your network to the WAN LAN1 port on the back panel of the N8800 2 Connect the provided power cord into the universal power socket on the back panel Plug the other end of the cord into a surge protector socket Press the power supply switch to turn on the power supply 27 28 Chapter 3 First Time Setup Overview Once the hardware is installed physically connected to your network and powered on you can configure the Thecus IP storage so that it is ac
78. ally receives a license from the original licensor to copy distribute or modify the Program subject to these terms and conditions You may not impose any further restrictions on the recipients exercise of the rights granted herein You are not responsible for enforcing compliance by third parties to this License If as a consequence of a court judgment or allegation of patent infringement or for any other reason not limited to patent issues conditions are imposed on you whether by court order agreement or otherwise that contradict the conditions of this License they do not excuse you from the conditions of this License If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations then as a consequence you may not distribute the Program at all For example if a patent license would not permit royalty free redistribution of the Program by all those who receive copies directly or indirectly through you then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program If any portion of this section is held invalid or unenforceable under any particular circumstance the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any
79. and RAID 6 Gigabit Ethernet ports enhance network efficiency allowing Thecus IP storage to take over file management functions increase application and data sharing and provide faster data response The Thecus IP storage offers data mobility with a disk roaming feature that lets you swap working hard drives for use in other Thecus IP storage securing the continuity of data in the event of hardware failure The Thecus IP storage allows data consolidation and sharing between Windows SMB CIFS UNIX Linux and Apple OS X environments The Thecus IP storage s user friendly GUI supports multiple Languages Product Highlights File Server First and foremost the Thecus IP storage allows you to store and share files over an IP network With a Network Attached Storage NAS device you can centralize your files and share them easily over your network With the easy to use web based interface users on your network can access these files in a snap To learn about the Web User Interface go to Chapter 5 Using the Thecus IP Storage gt Using WebDisk FTP Server With the built in FTP Server friends clients and customers can upload and download files to your Thecus IP storage over the Internet with their favorite FTP programs You can create user accounts so that only authorized users have access To set up the FTP Server refer to Chapter 4 System Network FTP iTunes Server With the built in iTunes server capability the Thecus IP stora
80. b disk directory Must input the complete file name Ld new file Directory Creates a new folder or directory 122 Search files in the directory You can only input some word string There is also the way by using right click button to f Directory Tree a A bring up contact windows as short cut to operate what you needed 3E iTunes music t test testi By Ji New File Directory Aa Reload PA Cancel Photo Server Using the Photo Server users can view and share photos and even create their own albums right on the Thecus IP storage You will see your own Photo Gallery and all public Photo Albums on the network To manage any picture files you must first select the item by clicking the box then enter user name and password to login photo server 123 T is Thecus Creator in Storage ARALIN DOSAO Pholas alin s album Protect Your Sou Secure w Data Windows XP Publishing Wizard There are many ways for a local user to upload pictures into their photo album Users of Windows XP can upload their pictures using the Windows XP Publishing Wizard 1 Click on the XP Publishing Wizard icon on top right core 2 The XP Web Publishing Wizard Client screen appears Click on the link to install the Publishing Wizard T Thecus Creator In Storage af AAPA Snort Lori Wa Secure your Data 3 Windows XP will ask whether you want to run or save this file Click Save to save
81. cation enter a username and a password Confirm your chosen password be reentering it in the Password Confirm box 10 Click OK to create the iSCSI volume Modify ISCSI Volume To Modify iSCSI volume on the current RAID volume follow the steps below 1 Under the Volume Allocation List click Modify The Modify 1SCSI Volume screen appears Menu Gf My favorite UM System Trifanmatinn Space Allocation p 4 creer Management i RAID Information System Hebwark 4 Master op RAID Statue Disks Tota Data SCSI RAJD r Lewel CERTUS Jsed Capacty Capacity Capacity E35 I J 272774 T r m uas A 7 7 heat RAID D Healthy 1 2 3722 2 0 2 GB 3424 4 GE 37 2 Ga Dix E RAD d Volume Allocation List Ol Space Alacat Ed Share Folder iSCSI Target GCS Thin Provision Target Advance Option F eg ak ee Cc RCRA LORIE 1I Stackable al TSO Mount al Acc g Mad my i e E perd igi Delete Ty Hame Capacity ae User and Group Authentication SCSI BgEOOpro 37 2 GE A pplcatun Server a Mou management 7 Space Allocation Es Create iSCSI Volume RAID ID RAID Unused 4 55 148 68 GB Alacation ET 148 88 GB Target Name Limit 09 az ign Year ign Manth LUN ID Authentication Username Limit 0 9 3 2 Az Password q Limi 0 9 az Asz length between 12 16 Password Confirme Description The iSCSI black se can be set under system advance option defauk 5 512 Bytes
82. cessible to your network users There are two ways to set up your Thecus IP storage using the Thecus Setup Wizard or the LCD display Follow the steps below for initial software setup Thecus Setup Wizard The handy Thecus Setup Wizard makes configuring Thecus IP storage a snap To configure the Thecus IP storage using the Setup Wizard perform the following steps 1 Insert the installation CD into your CD ROM drive the host PC must be connected to the network 2 The Setup Wizard should launch automatically If not please browse your CD ROM drive and double click on Setup exe 3 The Setup Wizard will start and automatically detect all Thecus storage devices on your network If none are found please check your connection and refer to Chapter 7 Troubleshooting for assistance Thecus Setup Wizard e Ga Device Discovery Version 1 2 0 Device Discovery Host Name 1 N8s00SAS 192 168 1 100 00 14 FD 1 2 60 64 J Login System J Network Configuration Enable Service Hard Disks Setup om MM S t lt CS Password us 2 Complete f neoan Poo 4 Select the Thecus IP storage that you like to configure 5 Login with the administrator account and password The default account and password are both admin 29 Thecus Setup Wizard m N Login System Version 1 2 0 J Device Discovery Login System A Network Configuration Enable Service Hard Disk
83. creen press the Edit button to go to the RAID Information screen Using Edit RAID you can select RAID ID and the Spare Disk F UH System Information ai RAID Information Se system Management ig System Network Masni RAID Status Disks Total Data SCSI yI RAD Level ves Used Capacty Capacity Capa a g Ed Storage RAD 0 Heakhy 1 2 3722 2 0 2 GB 3424 4 6B N Disks a Grab GE space Allocation fall Share Folder E r Stackable zA T50 Mount Bata Oist Llu ruzad men User and Group Authentication a Application Server af Module management RAID Information Expand Migrate RAID r Edit Desa Ho Capaoty MB Model Status Used Spare l 1 907 729 WOC WD2002 OK i 1 907 728 WOC WO OK 3 1 907 729 WOC VD2002 Vaming 4 1 907 729 WDC WD2Z02 OK 2 1 907 728 WDC WD2002 OK b 1 907 729 WOC WD2002 OR X RAID Level Jeo uu RAID E RAD 1 RAILS CI RAD B A RAID 140 AGW 0 9 a 2 Anz v Master RAID Take effect after checked box Encryption Fl Password Allow 1516 characters Confirm Password i Quick Raid F Enable the setting to enhance RAID creation time f there is rio partition existed inside of hard disk Stripe Size KH w Data Percentage lt iE Fae System Esra pw RAID Configuration x 9 j All current active services will be stopped when operation is in progress Are vou sure to update setting now No
84. ctory defaults are User Name admin Password admin X If you changed your password in the setup wizard use the new password Once you are logged in as an administrator disclaimer page will appear as below Please click the check box if you do not want to have this page displayed during the next login Disclaimer TOPE TTS hae pa Gaheleter s mEmnTq1mmMRG peeadental pr omaia 4 sga haza incl THECUS has no liability consequential incidental or special damages These include without limitation loss of recorded data the cost of recovery of lost data lost profits and Uk ee P we EE ERR E TEILS 12 ERE Ree g Ea E El a o the cost of the installation or removal of any THECUS products the installation of THETIS defect or by the repair or replacement of Products arising from a defect in any THECUS products Users can now register their Thecus NAS online Simply go to the online registration page and enable the registration function The registration page states what system information will be kept in the archive Users will receive firmware upgrade and module release notice regularly Iagree Don t show this message next time OR 37 Following by disclaim page you will see the Web Administration Interface From here you can configure and monitor virtually every aspect of the Thecus IP storage from anywhere on the network My Favorite The user interface with My Favorite shortcut is allowed u
85. e Unplug the power cord and all connected cables before cleaning DO NOT place any objects on the Thecus IP storage or obstruct its ventilation slots to avoid overheating the unit Keep packaging out of the reach of children If disposing of the device please follow your local regulations for the safe disposal of electronic products to protect the environment Table of Contents Copyright and Trademark Notice cree erre 2 About This Manualu is vkxa vd RO RON COL RR RO R RR CA RR QR RH AER RACER C n T 2 Limited WarFallby isicersk ecl xix MODO SX RC ON RR M An RE A ROCCO CR RD RC CR ER RR RD 2 Safety WarhIldS caras esvseonazS waa REFYFVEAERVREERERENEREPKEREEFIENARERFERRARREREEFKE 3 Table of COnDEenLts ice anda OR WAGE CAD ROE OCHO RR GIOCO CROCO ROC RC RO EROR 4 Chapter 1 Introduction iai ERR SERRE ERIE NC DRE RE EE ERRKEERWRCKERERAS KR 7 OVerVIeW S oisednu vida NEaaEeEs Eos a QUEE CNN UNUS ME MENU BM 7 Product Highlights xc exixis ki nx Rr GC RR QR GE x Rn RR RO RC x 7 P ckage Contents ood vaveri ena ves av Cuv aa aa a LV WE qx Fas a Caras a Wn WEGE 9 Front Panels eu ER a NER RRAWANERRNMEECKLIDEI EL NER E RR M TRYSI RN KEEPER Rr o 10 Hard DISK TRAYS Giridibisa eda asaEuSAQuS QNSE RIA IAFI MF UMEN RNMEUM XI DIU I EMI KI DEMNM ER 16 Rear Palel sis sandra Rae ROC ROG X GIC RC aa 17 Chapter 2 Hardware Installation see 23 OVervIGW iuvicivixksksERARARMREREMAFIHEREKEF
86. e network configuration settings as well as service support settings WAN LAN1 WAN LAN1 Configuration From the System Network menu choose WAN LAN1 and the WAN LAN1 Configuration screen appears This screen displays the network parameters of the WAN LAN1 connection You may change any of these items and press Apply to confirm your settings See a description of each item in the following table Meru 9M System Information WAN LAN1 Configuration 65e sem Management Host Name HATU P ROC Domain Name thecue com a e ester Neb work WINS Server i WINS Server 2 R MAC Address DO 14 FD 10 DA 20 Link Detected yes Link Speed LOOOMbys Jumka Frane Disdble Supipert s vene spi aed Disk IP Sharing Mode Enable 9 Disable Serr Link Aggregation inle v Li nem pes Set IP Address by Bonjour F Shetic Dynamic IF T72 16 64 1531 Metmask 23 53 29 Galea 172 16 66 135 DHS Server 172 16 66 244 166095 1 1 Storage aai LSet and Group Authentication iN erm E Application Server WAN LAN1 Configuration Mem Description OOOO Jumbo Frame Support Enable or disable Jumbo Frame Support of the WAN LAN1 interface on your Thecus IP storage IP Sharing Mode When enabled PCs connected to the LAN2 port will be able to access the WAN LAN1 Link Aggregation Specifies whether WAN LAN1 and LAN2 ports will be aggregated and act as one port There are 6 modes can be choose from
87. e single client access share folder in writing under SMB CIFS protocol Samba Recycle Bin The Thecus IP storage is supported recycle bin via SMB CIFS protocol Simply enable it then all of deleted files folders will reside in the recycle folder with hidden attribution in each share 77 m Fs i j hap Cong ues In general Windows has default to invisible all of hidden folders files So please enable this option to view recycle folder Samba Anonymous Login Authentication To enable this option no matter there is share folder has been created in public access The user account and password is needed from system to access under SMB CIFS protocol On the other hand no more anonymous login is allowed Samba is Native mode The Thecus IP storage is supported Samba mode options In the ADS environment with Native mode selected then Thecus IP storage is capable to become local master position UNIX Extension The default is enable for Samba usage with situation using Mac OSX with smb connection may have permission issue When it happened please setup UNIX Extension disable to get issue solved 56 AFP Apple Network Setup From the System Network menu choose the AFP item and the AFP Support screen appears This screen displays the configuration items for the Apple Filing Protocol You can change any of these items and press Apply to confirm your settings Menu u My favorite d System Infor
88. ent Volume Allocation List Description Modify Click this to modify the allocated space Click this to delete the allocated space 75 Allocating Space for iSCSI Volume U My favorite B System Information Space Allocation w oe Ti Man agenment RAM Information p System Hebw rk Master m RAID Status Disks Total Data SESI RAID Level ised Capacty Capacity Canacicy Ed storage RAID D Heathy 1 2 3722 2 0 26GB 3424468 37 2 GB x Deks T R ATO s i Volume Allocation List Space Aldacati Ed Share Folder SCSI Target SCSI Thin Provision Target Advance Ontian ae p a E Stackable 2 Ten Maunt Add Modfy Expand g eee Capacity 37 2 GB an User and Group Authentication 98 Application Server a Mogi management Fri ARE o P SAGE r r To allocate space for an iSCSI volume on the current RAID volume follow the steps below 1 Under the Volume Allocation List select iSCSI Target then click Add The Create iSCSI Volume screen appears Space Allocation Create iSCSI Volume RAID ID RAID Unused 4 95 148 88 GB z J 148 88 GB SCSI Target Volume 5 Enable ig Disable Target Name IL mit 0s9 a z in wr qn Year 2010 gn Month 08 LUN ID la None 2 CHAP Allocation cl Authentication Username Limit 0 9 a2 Az Password Lim 049 az AZ length between 12 16 Password C
89. erms of Sections 1 and 2 above provided that you also do one of the following a Accompany it with the complete corresponding machine readable source code which must be distributed under the terms of Sections 1 and 2 aboveon a medium customarily used for software interchange or b Accompany it with a written offer valid for at least three years to give any third party for a charge no more than your cost of physically performing source distribution a complete machine readable copy of the corresponding source code to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange or C Accompany it with the information you received as to the offer to distribute corresponding source code This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer in accord with Subsection b above The source code for a work means the preferred form of the work for making modifications to it For an executable work complete source code means all the source code for all modules it contains plus any associated interface definition files plus the scripts used to control compilation and installation of the executable However as a special exception the source code distributed need not include anything that is normally distributed in either source or binary form with the major components compiler kernel and so
90. ers To set up an iSCSI volume refer to Chapter 4 Storage Management gt Space Allocation gt Allocating Space for ISCSI Volume Superior Power Management Thecus IP storage supports schedule power on off With this feature administrator can set at what time to turn on or off the system This feature is a big plus for people who want to conserve energy Wake On LAN enables administrator to remotely turn on the system without even leaving their own seat To schedule system on and off refer to Chapter 4 System Management gt Scheduled Power On Off Package Contents The Thecus IP storage should contain the following common items e System Unit x1 QIG Quick Installation Guide x1 e XCD Title x2 Acronics backup CD except N0503 Twonky media server CD amp Universal CD Ethernet Cable x1 Accessory bag x1 HDD Compatibility list Card x1 Multiple Languages Warranty Card x1 Power cord x1 Your N0503 package should contain additional items e 3tob5 HDD cage x1 Installed e 3 5 HDD rail x6 e Power Adaptor Power cord x1 Your N4200 series package should contain additional items e Power adapter Power cordx1 Your N5500 package should contain additional items e USB Cable A B Type x1 Your 1U4600 package should contain additional items e Power Cord B 1U4600R x1 e USB Cable A B Type x1 Your N8800 series package should contain additional items e Power Cord x1 Please check to see if your package i
91. es a No Share Folder Limit 0 GB Add Folder RAID ID Folder Name Description Browseable Enable or disable users from browsing the folder contents If Yes Public Admit or deny public access to this folder If Yes is selected then users do not need to have access permission to write to this folder When accessing a public folder via FTP the behavior is similar to anonymous FTP Anonymous users can upload download a file to the folder but they cannot delete a file from the folder Share Folder Limit Enter the maximum size of the folder in Gigabytes GB The folder cannot grow beyond this limit You can enter a 0 to turn off the share folder limit This option did not apply while XFS file system selected Apply Press Apply to create the folder Folder names are limited to 60 characters Systems running Windows 98 or earlier may not support file names longer than 15 characters 85 Modify Folders On the Folder screen press the Edit button and the Modify Folder screen appears This screen allows you to change folder information After entering the information press Apply to save your changes Modify Folder x RAID ID Folder name nsync Deseriptien tisync Browseable 7 Yes No Public E Yes No Share Folder Limit 0 GB Modify Folder Item J Description Enable or disable users from browsing the folder contents This setting will only apply while access via SMB CIFS and web disk
92. eveloped by the University of California Berkeley and its contributors This product includes software developed by Winning Strategies Inc This product includes software developed by the Apache Group for use in the Apache HTTP server project http www apache org This product includes software developed by Softweyr LLC the University of California Berkeley and its contributors This product includes software developed by Bodo Moeller This product includes software developed by Greg Roelofs and contributors for the book PNG The Definitive Guide published by O Reilly and Associates This product includes software developed by the NetBSD Foundation Inc and its contributors This product includes software developed by Yen Yen Lim and North Dakota State University This product includes software developed by the Computer Systems Engineering Group at Lawrence Berkeley Laboratory This product includes software developed by the Kungliga Tekniska H gskolan and its contributors This product includes software developed by the Nick Simicich This product includes software written by Tim Hudson tjh cryptsoft com This product includes software developed by Christopher G Demetriou for the NetBSD Project 148 CGIC License Terms Basic License CGIC copyright 1996 1997 1998 1999 2000 2001 2002 2003 2004 by Thomas Boutell and Boutell Com Inc Permission is granted to use CGIC in any application commercial or nonco
93. evice On the Nsync target server the administrator of that server has to set up a user account with a folder named nsync and grant write access 1 On the Nsync server add a user for Nsync source ex nsyncsource1 For instructions on how to add a user on the Thecus IP storage see Chapter 4 User and Groups Authentication Local User Configuration Add Users 2 On the Nsync server grant that user ex nsyncsource1 write access to the nsync folder For instructions on how to set up a folder s ACL see Chapter 4 Storage management Shore Folder Folder Access Control List ACL 3 Once this is done the target server will start accepting Nsync tasks from server using that ID and password Setting Up an Nsync Target on another Device other than Thecus IP storage If you selected Legacy FTP Server when setting up your Nsync task the Thecus IP storage will use the FTP protocol to back up the share folder On the external storage device make sure there is a folder named nsync and the Auth ID has writable permission in that folder Designating Thecus IP storage as an Nsync Target The Thecus IP storage can act as an Nsync server enabling another Nsync equipped Thecus NAS at a remote location backup their files to this Thecus IP storage From the System Network menu choose the Nsync Target item and the Nsync Target Server screen appears Nsync Target Server Setting Item Description O O Nsync
94. f the hard disk you wish to designate as a spare disk 2 Click Add Spare The disk will be configured as a spare disk The system automatically rebuilds the spare disk when one of the disks in the RAID set fails Remote Administration You can set up your Thecus IP storage for remote administration With remote administration you can access your Thecus IP storage over the Internet even if your Thecus IP storage is behind a router This is especially useful if you are traveling and suddenly need a file from your Thecus IP storage Setting up remote administration is a three part process and will require the following equipment Thecus IP storage device Cable DSL Router with Dynamic DNS support Home PC Internet Connection Router setup will differ slightly depending on router used For this example we will use the Asus WL500g because it has support for Dynamic DNS Contact your router hardware vendor for setup help 138 Part Setup a DynDNS Account 1 Goto http www dyndns org from your home PC 2 Click on the Sign Up Now link 3 Check the Check boxes select a user name i e N8800 enter your email address i e xxx example com check Enable Wildcard and create a password i e xxxx 4 Wait for an email from www dyndns org 5 Open the email and click on the link to activate your account Part Il Enable DDNS on the Router 1 Go to the router setup screen and select IP Config gt Miscellaneous
95. folder 5 Click the Browse button to find the folder over your network Alternatively you may enter the folder name you wish to connect to or enter its IP address i e 192 168 1 100 share 6 Click Finish When the Connect As window appears enter your user name and password 7 Click OK The share folder appears as the drive you assigned You can now access this folder as though it were a drive on your computer Apple OS X On an Apple computer you can connect to shared computers and servers using a network address 1 2 Choose Go gt Connect to Server Enter the network address for the server in the Server Address text box When connecting using SMB CIFS protocol type smb 747192 168 1 100 Fo0Lkcde l When connecting using AFP protocol type afp 192 168 1 100 Folderl Click Connect When MAC OS X is trying to connect Thecus IP storage it will ask for a User Name and Password which has access to the folder When MAC OS X has connected to Thecus IP storage successfully an icon representing the folder will appear on the MAC OS X desktop You can access the folder by double clicking on the icon Mapping Thecus IP storage as an iSCSI Drive With Thecus IP storage you are able to map it as an iSCSI drive With iSCSI you can remotely access Thecus IP storage at great speeds as if it were installed as a local drive in your computer To do this simply follow the steps below 132 Windows 2000 XP 1 First
96. formation e Sys em Management New Password EE cup s tanir 3 B utin Passer Or r Change Display Module Password Mp Fla system Check v New Password ig System Network Canim E Storage Password wa User and Group Authentication soph et amp ES Paal TE LAT cugply E Application Server See the following table for a detailed description of each item Change Administrator and LCD Entry Password Type in a new administrator password 49 Confirm Password Type the new password again to confirm Apply Press this to save your changes Config Mgmt From the menu choose the Config Mgmt item and the System Configuration Download Upload screen appears From here you can download or upload stored system configurations Menu My davorite En system Information System Configuration Download Upload 4 System Management EE cpap Upload Please choose a file to upload aE hity Daunica AGmmnisrrator Hesse Config Mgmt reboot amp Shut owr See the following table for a detailed description of each item System Configuration Download Upload Description Save and export the current system configuration Upload Import a saved configuration file to overwrite current system configuration Backing up your system configuration is a great way to ensure that you can revert to a working configuration when you are experimenting with new system settings
97. ge Local User Configuration From the Accounts menu choose the User item and the Local User Configuration screen appears This screen allows you to Add Edit and Remove local users Menu My favonte rH System Information Local User Configuration System Management GpAdd ZEdt Remove E System Network User TD User Name 1 storage agn User and Group Authentication PADS B E Lacal CX User Li s ww nup Batch Input E Application Server sg Module management Tio topics to display e Pagel afl Local User Configuration Item Description OZO OZO O Oo O Add Press the Add button to add a user to the list of local users Press the Edit button to modify a local user Press the Remove button to delete a selected user from the system Add Users 1 Click on the Add button on Local User Configuration screen and Local User Setting screen appears 2 On the Local User Setting screen enter a name in the User Name box 102 3 Enter a User ID number If left blank the system will automatically assign one 4 Enter a password in the Password box and re enter the password in the Confirm box 5 Select which group the user will belong to Group Members is a list of groups this user belongs to Group List is a list of groups this user does not belong to Use the lt lt or gt gt buttons to have this user join or leave a group
98. ge enables digital music to be shared and played anywhere on the network To set up the iTunes Server refer to Chapter 4 Application Server iTunes Configuration Backup Server Don t leave precious data to chance With advanced backup capabilities you can easily upload mission critical files to the Thecus IP storage and even automate your backup tasks for true peace of mind To find out how to backup your files with the Thecus IP storage refer to Chapter 4 Backup Nsync Printer Server With the Thecus IP storage s Printer Server you can easily share an IPP printer with other PCs connected to your network To set up the Printer Server refer to Chapter 4 Application Server Printer Information Multiple RAID Thecus IP storage supports multiple RAID volumes on one system So you can create RAID O for your non critical data and create RAID 1 5 or 6 depend on model for mission critical data Create the RAID levels depending on your needs To configure RAID modes on the Thecus IP storage refer to Chapter 4 Storage Management gt RAID Information ISCSI Capability Thecus IP storage is not only a file server but it also supports iSCSI initiators Your server can access Thecus IP storage as a direct attached storage over the LAN or Internet There is no easier way to expand the capacity of your current application servers All the storage needs can be centrally managed and deployed This brings ultimate flexibility to us
99. get IP address of the stackable device and click the Discovery button The system will list available target volumes from the inputted IP address Once IP with volume have been set you may need to input a valid user name and password to validate your access rights If there is no user name and password needed to access target volume then leave it blank Once IP with volume have been set you may need to input a valid user name and password to validate your access rights If there is no user name and password needed to access target volume then leave it blank Add iSCSI Target Add Stack Target X Enable iSCSI Target 7 Enable Disable Stackable Target IP 172 16 65 157 ign ign 2009 05 com thecus XFS 1scs10 vg 1sesi Username Password Export share name Limit 0 9 a z Description Browseable Qi yes F no Apay qutt Publie C yes Qi tc The Export share name will become the network share name and displayed through network access such as SMB You may refer the figures below to see the result Please note the naming limitation 93 Add iSCSI Target Add Stack Target Enable iSCSI Target Enable 7 Disable Stackable Target IP 172 16 66 39 2009 6 com thecus aaaaiscsi0 vge abed o Browseable yes no Public Cy yes no From the figure above the Export share name is pmmeeting The figures below show the result before and after via Microsoft
100. he LCD will display the USB copy progress and results 33 OLED Operation N4200 series OLED Operation The N4200 series is equipped with an OLED on the front for easy status display and setup There are four buttons on the front panel to control the OLED functions OLED Controls Use the Up A Down V Enter J and Escape ESC keys to select various configuration settings and menu options for N4200series configuration The following table illustrates the keys on the front control panel OLED Controls Icon Function Description A Up Button Select the previous configuration settings option v Down Button USB copy confirmation display Enter Enter the selected menu option sub menu or parameter setting ESC Escape Escape and return to the previous menu There are two modes of operation for the OLED Display Mode and Management Mode Display Mode During normal operation the OLED will be in Display Mode Display Mode Item Description O 1 1 10 O The N4200 series will rotate these messages every one two seconds on the OLED display 34 Typical Setup Procedure From the Web Administration Interface you can begin to setup your Thecus IP storage for use on your network Setting up the Thecus IP storage typically follows the five steps outlined below For more on how to use the Web Administration Interface see Chapter 4 Web Administration Interface Step 1 Network Setup From the Web Administratio
101. he disk will show Warning This warning is only used to alert the system administrator that there are bad sectors on the disk and they should replace those disks as soon as possible Bad Block Scan On the Disks Information screen you may also perform disk bad block scan simply to click Click to start to start with The result is only for reference and system will not take any action from its result Disks Information Disk No Capacity MB Model Firmware status Bad Block Scan 1 907 729 WDC WD2002FYP5 0 04 0 HR OK b Click to start 2 1 907 729 WDC WD2002FYP5 0 04 0 BR OK P Chek to start 3 1 907 728 WDC WD2002FYPS 0 04 0 oe Warning P Chick to start 1 907 728 WDC WDO2002FYPS 0 04 0 Zu OK b Chek to start 5 1 907 729 WDC WD2002FYPS 0 04 0 Db OK b Click to start 5 1 907 728 WDC WD2002FYP5 0 04 0 BR OK b Chick to start 7 1 907 728 WDC WD2002FYP5 0 04 0 BR OK b Click to start B 1 907 729 WDC WD2002FYPS 04 0 i OK P Click to start Total Capacity 15261832 MB The testing result will be stay till system reboot with Yet to start displayed as default RAID Information From the Storage menu choose the RAID item and the RAID Information screen appears This screen lists the RAID volumes currently residing on the Thecus IP storage From this screen you can get information about the status of your RAID volumes as well as the capacities allocated for data and iSCSI There is also a graph which represents how the RAID volume is cur
102. ice is powered on e Blinking blue eSATA hard disk is connected and active Reset Button e Resets the 1U4600 indi e Press for five seconds during boot process to reset IP address and admin password e Locks are provided for added security LCD Display e Displays current system status and warning messages e Displays hostname WAN LAN1 LAN2 IP address RAID status and current time Up Button A e Push to scroll up when using the LCD display Down Button W e Push to scroll down when using the LCD display Enter Button 4 e Push to confirm information entered into the LCD display Escape Button ESC e Push to leave the current LCD menu 14 N8800 series The Thecus N8800 series front panel has the device s controls indicators and hard disk trays Front Panel e Solid red system fan failure notification e Mute the system fan alarm e USB 2 0 port for compatible USB devices such as USB disks USB printers and USB wireless dongles Note For supported USB wireless dongles please contact http esupport thecus com support e Push to scroll up when using the LCD display e Push to enter USB copy operation screen e Push to enter LCD operate password for basic system setting 10 Escape Button e Push to leave the current LCD menu ESC 15 Hard Disk Trays 1U4600 N7700 series NS8800series Each of mentioned above models hard disk trays has a lock a latch and two LED indicators Hard Disk Trays Item Description
103. icrosoft thecus 2c1 tb4b4 thecus Target secret C Perform mutual authentication To use mutual CHAP specify an initiator secret on the Initiator Settings page and configure that secret on the target 12 Right click My Computer on the desktop and select Manage 3 Desktop a My Documents gu p x A TEE Collapse E ae AITE Explore we ATA Open cH Sw FAT3 Search ok DDE gj see publid Map Network Drive 5 Ea Faeo Disconnect Network Drive L Dr Cont Delete E 4 My Netwe Rename T Recycle E Properties 13 Click on Disk Management and you will see a new hard disk listed EI Computer Management Im File Action View Window Help e ome Aas m Computer Management Local Volume File System Status lil System Tools EJAITEXP2 C Partition Basic Healthy System 4 89 GB fil Event Viewer i Partition Basic Healthy 64 75 GB E Shared Folders Partition Basic Healthy 4 88 GB Local Users and Groups t E Performance Logs and Alerts x Device Manager eu Storage Removable Storage Disk Defragmenter e Disk Management Services and Applications pP amp Disk 0 Basic AITEXP2 C DATA D FAT32 G 74 53 GB 4 89 GB NTFS 64 75 GB NTFS 4 89 GB FAT32 Online Healthy System Healthy Healthy Disk 1 H M1 Unknown 69 59 GB 69 59 GB Not Initialized Unallocated cS CD ROM 0 DVD L gt Bi Unallocated Bl Pr
104. ics Local Group Configuration From the Accounts menu choose the Group item and the Local Group Configuration screen appears This screen allows you to Add Edit and Remove local groups 104 Local Group Configuration g Add quo Edit Remove Group ID Group Name 102 users Pase T of 1 d Displaying topics 1 lof 1 Local Group Configuration Description Press the Add button to add a user to the list of local groups Press the Edit button to modify a selected group from the system Press the Remove button to delete a selected group from the system Add Groups On the Local Group Configuration screen click on the Add button The Local Group Setting screen appears Enter a Group Name Enter a Group ID number If left blank the system will automatically assign one Select users to be in this group from the Users List by adding them to the Members List using the lt lt button 6 Click the Apply button to save your changes aa d Add x Local Group Setting Users List Group Name Search Group ID 103 UserID User Name 1002 User Members List UserID User Name Apply 105 Edit Groups 1 On the Local Group Configuration screen select a group name from the list 2 Press the Edit button to modify the members in a group 3 To add a user into a group select the user from the Users List and press the button to move the user into the Members List 4 To remove a user from a gr
105. ies and user privileges on an ADS server can be enforced automatically on Thecus IP storage 2 Centralized user password database The Thecus IP storage does not maintain its own copy of the user password database This avoids data inconsistency between Thecus IP storage and other servers For example without ADS support an administrator might need to remove a specific user privilege on Thecus IP storage and each individual server With ADS support the change on an ADS server is known to all of its ADS members 147 Appendix D Licensing Information Overview This product included copyrighted third party software licensed under the terms of GNU General Public License Please see THE GNU General Public License for extra terms and conditions of this license Source Code Availability Thecus Technology Corp has exposed the full source code of the GPL licensed software For more information on how you can obtain our source code please visit our web site http www thecus com Copyrights This product includes cryptographic software written by Eric Young eay cryptsoft com This product includes software developed by Mark Murray This product includes software developed by Eric Young eay cryptsoft com This product includes software developed by the OpenSSL Project for use in the OpenSSL Toolkit http www openssl org This product includes PHP freely available from http www php net This product includes software d
106. ies of free software and charge for this service if you wish that you receive source code or can get it if you want it that you can change the software or use pieces of it in new free programs and that you know you can do these things To protect your rights we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights These restrictions translate to certain responsibilities for you if you distribute copies of the software or if you modify it For example if you distribute copies of such a program whether gratis or for a fee you must give the recipients all the rights that you have You must make sure that they too receive or can get the source code And you must show them these terms so they know their rights We protect your rights with two steps 1 copyright the software and 2 offer you this license which gives you legal permission to copy distribute and or modify the software Also for each author s protection and ours we want to make certain that everyone understands that there is no warranty for this free software If the software is modified by someone else and passed on we want its recipients to know that what 149 they have is not the original so that any problems introduced by others will not reflect on the original authors reputations Finally any free program is threatened constantly by software patents We wish to avoid the danger that redistributors of a
107. imary partition ll Extended partition Bl Logical drive 14 Initialize the new hard disk and you will then be able to use the iSCSI target as a local drive 136 Windows Vista Because Windows Vista has the Microsoft iSCSI Initiator pre installed you will not have to install this piece of software Instead start the iSCSI Initiator and follow steps 8 14 to map the Thecus IP storage as an iSCSI drive 137 Chapter 6 Tips and Tricks USB and eSATA Storage Expansion The Thecus IP storage supports external USB hard disks through its USB ports Once a USB hard disk has successfully mounted the entire volume will be linked automatically to the default USB HDD folder The Thecus IP storage supports USB external storage devices All file names on the USB disk volume are case sensitive The Thecus IP storage also supports eSATA hard disks with its eSATA port Before attaching an eSATA or USB disk drive to Thecus IP storage you have to partition and format it on a desktop computer or a notebook first The attached device will be located at 192 168 1 100 usbhdd sd x 1 where 192 168 1 100 means the IP address of Thecus IP storage and sa x 1 stands for the first partition on the eSATA or USB disk drive Adding a Spare Disk With a RAID 1 RAID 5 RAID 6 or RAID 10 volume you can add a spare disk after the initial RAID is setup To add a spare disk follow the steps below 1 Onthe RAID Configuration Screen tick the checkbox o
108. ional Tasks Click Browse this CD In Windows Explorer navigate to ValueAdd gt Msft gt Ntbackup Double click Ntbackup msi to install the backup utility Once installed you can use the Windows Backup Utility by following the steps below 1 Click Start and point to All Programs gt Accessories gt System Tools gt Backup to start the wizard Click Next to skip past the opening page Choose Backup files and settings from the second page and then click Next Select which option you want to back up Click Next and in the Backup Type Destination and Name page specify a back up location using the Browse button Find and select the drive that specifies your Thecus IP storage as your backup destination and click Next Click Next to display the wizard s final page and click Finish to start backing up Apple OS X Backup Utilities Mac OS X does not include any backup software However there are a number of backup solutions available for the Mac OS X including iBackup Psyncx iMSafe Rsyncx Folder Synchronizer X Tri BACKUP Impression Intego Personal Backup SilverKeeper and Apple s dotMac Backup utility to name just a few To find even more freeware and shareware backup utilities to choose from go to VersionTracker or MacUpdate and search on backup 120 Chapter 5 Using Thecus IP Storage Overview Once the Thecus IP storage is setup and operating users on the network may manage all varieties of digi
109. ister Web UI Language There are Te more Ferme Wwe ike ro ger E Back Tor statene and anas purpose upon to your agreement 7 Internal HOD branding and FV version F Time Zone e Eyre m Manage ment z al E System Matwork zd Storage ma User and Group Authentication il Application Server we Module management hal ad Backup E 4 Other than the defined items sent upon registration there are also two additional items HDD Info and Time Zone These two optional items can also be sent to Thecus anonymously for analysis and statistics purposes To send these items simply check the desired checkboxes to help Thecus improve its products and services Registration option y Enabl The following information will be recorded after Enable checked Product Hodel Hanse Current FW versson Mac address of WAN Hail address of system natificatian Web ui Language There are tow mort terme we ike to get E back for satitik and analyse pumpose upon to your agreement Internal HDD branding amd Fy wargan List of most recent update SPAN pma e Pubksh dare In nmrationi Dabary 2003 10 23 ui Fave mew Amane 3 0 00 46 2005 10 14 1 D 2 2D03 10 14 15 23 28 You have re madue IP Carm 1 0 82 Sse You have pew mhiu IP Carm 1 0 61 2003 10 14 15 Lz dOG You rave reu mague IP zer 1 0 6 2009 10 14 15 22 24 Yu Fame niei module P Carn 1 0 59 2009 10 13 ISAS Yo have maw mocule IP Carn 1 0 56
110. istrators ID of Windows Active Directory or Windows NT which is required for Thecus IP storage to join domain Administrator Enter the ADS NT Administrator password Password Apply To save your settings To join an AD domain you can refer the figure and use the example below to configure the Thecus IP storage for General Network Identification Hardware User Profiles Advanced associated filed input System Properties iL Er A xJ La Windows uses the following information to identify your computer ieee onthe network Full computer name computer domain local ADS Semer Name T iisa Domain domain local c THIS a Work Group Domain Name li ADS Ream 0 a reniamie this computer ar join a domai click LUTTER Properties Note The identification of the computer cannot be changed because The computer is a damam controller 101 AD Domain Example Work Group Domain domain Name ADS Support ADS Server Name ADS NT Realm Administrator ID Administrator OK OK IK kk Password The DNS server specified in the WAN LAN1 configuration page should be able to correctly resolve the ADS server name e The time zone setting between Thecus IP storage and ADS should be identical The system time difference between Thecus IP storage and ADS should be less than five minutes The Administrator Password field is for the password of ADS Active Directory Server not Thecus IP stora
111. ize _ BT Seed Andy Weekly Report CJ AMD Besttech GT ACS xxx AMCC Thecus 02 iso Thecus 01 iso _ Adobe Acrobat 7 0 Pro J ATOM Andy Private Ki 4 Pagef ofi b MG No iso mount information to display File Selected Mount as Description Onty ISO 9660 file system can be mounted Top 50 Folders Add Top 50 Files Please type in the full path of the ISO if not listed 98 V ISO filter 4 j naswebsite LBT Seed Andy Weekly Report AMD Besttech GT LJ ACS xxx _ Adobe Acrobat 7 0 Pro LJ ATOM Andy Private K 4 Pae of1 b DU No iso mount information to display Description Onty ISO 9660 file system can be mounted Top 50 Folders Add Top 50 Files Please type in the full path of the ISO if not listed To mount new ISO file select from listed ISO file and input desired mounting name into Mount as field Click ADD with confirmation to complete mounting ISO file Or without Mount as ISO file export name input system will automatic to give the export name by ISO file name If left Mount as blink then system will create mount point by ISO file name ISO Mount Are you sure to mount the 2 ISO E Tiecus 01 iso ISO Mount i naswebsite Thecus 01 iso is mounted After you have completed to add ISO then the page will displayed all mounted ISO files 99 4 j naswebsite Mounted Path ISO Path ISO Size IBT Seed L A
112. l need to install the Thecus Setup Wizard on a host machine with one of these operating systems before using the unit LCD Operation N5500 1U4600 N7700 series N8800 series The mentioned models above are equipped with an LCD on the front for easy status display and setup There are four buttons on the front panel to control the LCD functions LCD Controls Use the Up A Down V Enter J and Escape ESC keys to select various configuration settings and menu options for Thecus IP storage configuration The following table illustrates the keys on the front control panel LCD Controls Icon Function Description A Up Button Select the previous configuration settings option v Down Button USB copy confirmation display 4 Enter Enter the selected menu option sub menu or parameter setting ESC Escape Escape and return to the previous menu There are two modes of operation for the LCD Display Mode and Management Mode Display Mode During normal operation the LCD will be in Display Mode Display Mode Current LAN2 IP setting Link Aggregation Current Link Aggregation status System Fani Current system fan1 status System Fan2 Current system fan2 status 31 CPU Fan Current CPU fan status 2009 05 22 12 00 Current system time Disk Info Current status of disk slot has been installed Current RAID status The Thecus IP storage will rotate these messages every one two seconds on the LCD display USB Copy The
113. ld 2 Once rebuilt you can continue to replace any remaining disks in the RAID array 3 When you are done replacing hard drives log on to Web Management Navigate to Storage RAID to open the RAID Configuration screen 70 4 On the RAID Information screen and click Edit to open the RAID Configuration screen 5 Onthe RAID Configuration screen click Expand NOTE RAID expansion did not support file system created by ZFS x RAID Configuration Da e i R RRA A lud RAID Information Unused 86 59 GB 60 Expand Capacity 8639 GB Migrating a RAID Once a RAID volume has been created you may want to move it to other physical drives or change the RAID array all together To migrate a RAID 0 RAID 1 RAID 5 or RAID 6 volume follow the steps below 1 From the RAID Configuration screen click Migrate RAID 2 A list of possible RAID migration configurations will be listed Select the desired migration scheme and click Apply 3 The system will begin migrating the RAID volume 71 LAID Intormabon Expand r Migrate RAID FODE Disk Ho Capacity MB Mode Status Usec Avelable Disk 1 1 907 729 WEC D2002 OK aic F 1 307 729 WDC D2002 OK 3 1 907 723 WDE VgD2002 Viamng m 4 1 907 729 WEC WO2002 OK C 5 1 807 725 WRC VZD2002 OK C 6 1 807 729 WEL WO2002 OK r1 RAID Levee C RAID gt RAID 0 Offline RAD 1 RAID 6 Orne 1 RAID D gt RAID 5 Ofira RAD 5 g
114. lick Apply to save your changes 47 Menu E NN UM system Information Schedule Power On Off d Sysrem Management Enable schedule Power On Off Acton Tre Acbon Tite Sunday v T 2 3 Monday x d 7 Tuesday wi Wednesday ww wr ww Thursday vw ind w n Mp File system Check Friday w c X ki Saturday w v i V Example Monday On 8 00 Off 16 00 System will turn on at 8 00 AM on Monday and off at 16 00 on Monday System will turn on for the rest of the week If you choose an on time but do not assign an off time the system will turn on and remain on until a scheduled off time is reached or if the unit is shutdown manually Example Monday On 8 00 System will turn on at 8 00 AM on Monday and will not shut down unless powered down manually You may also choose two on times or two off times on a particular day and the system will act accordingly Example Monday Off 8 00 Off 16 00 System will turn off at 8 00 AM on Monday System will turn off at 16 00 PM on Monday if it was on If the system was already off at 16 00 PM on Monday system will stay off Wake Up On LAN WOL The Thecus IP storage has the ability to be awoken from sleep mode via WAN LAN1 port Menu Fo My favorite iH olen Information Wake up On I an MP cystem Management WOL Service Enable a Diable si Tire A Pile py tificabr Appl wur Hrrmware Upgrade fa Schedule O From the menu choose the
115. lowing table illustrates the keys on the front control panel LCD Controls Icon Function Description v Down Button Select the previous configuration settings option A Up Button Select the next configuration settings option pel Enter Enter to display USB copy operation ESC Escape Escape to give up USB copy Press and hold for 3 seconds to turn off the LCD s backlight Press any button to switch the backlight back on Display Mode During normal operation the LCD will be in Display Mode Display Mode tem Description Current host name of the system Current WAN LANI IP setting Current LAN2 IP setting Current RAID status Current system fan status Current system temperature Current system date and time The system power on time since last start The N0503 will rotate these messages every three seconds on the LCD display NOTE If the RAID array is in a degraded state the LCD display will be stopped in display mode and show which disk is degraded in the array USB Copy The USB Copy function enables you to copy files stored on USB devices such as USB disks and digital cameras to the N0503 with a press of a button To use USB copy follow the steps below 1 Plug your USB device into an available USB port on the Front Panel 2 In Display Mode press the Enter J 3 The LCD will display USB Copy 4 Press Enter and the N0503 will start copying USB disks connected to the front USB port T
116. ly be up to 16000GB 16TB Let s take the example below 1 The physical size for the iSCSI thin provision volume is 333 88GB You can refer the screenshot above 2 The iSCSI target volume under thin provisioning starts with 333 38GB in physical size and you may use drag the Virtual Size bar to select the desired virtual size The maximum virtual size is 16000GB 3 In this case if you make the iSCSI target volume 1700GB then the virtual size is available for the next iSCSI target volume under thin provisioning is 14300GB 16000 1700 4 The limit is 5 iSCSI target volumes under thin provisioning or a virtual size of 16000GB RAID ID RAI Unused 18 333 85 GB Virtual Sze 333 8 GB iSCSI Thin provision physical size starts with 333 8GB Unused 15 3353 59 GB Virtual Size 16000 GB SCSI Target Volome V Enable Disable The virtual capacity is limited to 16000GB 81 The screen shot for iSCSI target volume creation under thin provisioning the physical capacity 333 8GB Space Allocation x Create IS S Thin Pririzion FAID ID Unused Virtual Sime CEI Target olome Target Name Limit 0 3 a z ipn Yaar 2000 lw ign_ Month 08 iw Authentecation E Nons CHAP Username Limiti0 3 a z A Z Pauxrzarnc ListXc 3 a2 z A mdlanzth betean 12 18 Pasgosd Conium Description The 13C51 block size can be set onder ryste advance option defili is 312 Bytes Plaasa ming 4K block size while
117. m Module ser Modda Not Installed MySQL 5 1 00 02 MySQL database nine ie 1 0 4 webserver 1 0 4 Web Server Online amp 1 0 3 LIES opy 1 0 3 USB copy module n twee Orina BR Eun The other way to have auto module installed is using universal CD shipped with system It has contained file modules zip which included all modules while system shipped Please refer the screenshot below The modules list getting on line of Thecus website will newly than thecus zip from shipped CD But the installation from Thecus website could have unpredictable duration due to bandwidth concern 113 My Pevorite TE system Information maipe mduezp f AM System Management Module Source List Fy System Mstwark installed Hama Version Description Location Dacument Action tat IP Can Ji IP Cai EL ex E Storage Mot Irstaled IP Cam 2 0 1 IP Cam Disk E x zm Not Irstalled Twonkymecdia 1 0 0 Twonrkymada Disk Em x aa oer and Group Authenticalion zz ae Not Installed webserver 1 0 4 Webserver Disk Bo x 4 Appicatian Server gf Modde management If Module instalation E Module Installation System Module Sart AS Auto Module Source List tem Description O Installed Status of module Name Module name Version The version of released version Description The description of module Location The module is either getting on line
118. mation r AFP Support X System Management AFP Server Biete Disable e ii System Network MACCHARSET vrEs w ura A OHE m Lah Ti i PX e Ha a ue era IB 1 Ks samba CIS me Machine J Enable Disasle S AFF Kurs Agply ETP ae Media Senat z A description of each item follows Apple Network Configuration Item Description 1 AFP Server Enable or disable Apple File Service to use Thecus IP storage with MAC OS based systems Specifics the code page from drop down list Zone Specifies Zone for Applet Talk service If your AppleTalk network uses extended networks and is assigned with multiple zones assign a zone name to Thecus IP storage If you do not want to assign a network zone enter an asterisk to use the default setting Time Machine Enable checked box while you like to backup you MAC system to have Thecus IP storage as MAC time machine NFS Setup From the System Network menu choose the NFS item and the NFS Support screen appears The Thecus IP storage can act as an NFS server enabling users to download and upload files with the favorite NFS clients Press Apply to confirm your settings Menu My favorite H System Information r NFS Support MP System Management NFS Enable Disahle E System Heberark i l A J M L cula RU ET AT li unm E y IAN t ig gt Wi samb
119. mmercial at no cost HOWEVER this copyright paragraph must appear on a credits page accessible in the public online and offline documentation of the program Modified versions of the CGIC library should not be distributed without the attachment of a clear statement regarding the author of the modifications and this notice may in no case be removed Modifications may also be submitted to the author for inclusion in the main CGIC distribution GNU General Public License Version 2 June 1991 Copyright O 1989 1991 Free Software Foundation Inc 51 Franklin St Fifth Floor Boston MA 02110 1301 USA Everyone is permitted to copy and distribute verbatim copies of this license document but changing it is not allowed PREAMBLE The licenses for most software are designed to take away your freedom to share and change it By contrast the GNU General Public License is intended to guarantee your freedom to share and change free software to make sure the software is free for all its users This General Public License applies to most of the Free Software Foundation s software and to any other program whose authors commit to using it Some other Free Software Foundation software is covered by the GNU Library General Public License instead You can apply it to your programs too When we speak of free software we are referring to freedom not price Our General Public Licenses are designed to make sure that you have the freedom to distribute cop
120. more than 2TB capacity will ba confizuead in Windows XD Please ming 512 Byte block size for application ka VhIware atc The screen shot to setup an iSCSI target volume under thin provisioning of 1700GB iSCSI Thin Privizion Volume T dExpand GP Dale ives ama Capacity ACA Thine Brecon Volcene ACSI Then Savion Vols 3353 8 63 iSCSI Thin Pririzion Dads QPMest E Delete iSCSI target volume creation The maximum virtual size is 14300GB 16000GB 1700GB 1 iSCSI target volume Space Allocation Create 13 51 Thin Pririzion RAID ID RAID Urused 18 4 333 28 GB 14300CB Vertual Bize aT 2543 GB SCSI Target Volsnte 7 Enable E Disable Target Name Linitx0 3 a z inn Year 2009 iw This screenshot lists iSCSI target volumes created under thin provisioning The 2 4 iSCSI target volume under thin provisioning has been created with a capacity of 14300GB 82 iSCSI Thin Privizion Volume X Expand m Delete ives am Lapacity DCRI Thin Preven Volume RCSL Then Paruszon Volome 353 8 68 iSCSI Thin Privizion QUAS quM GB Delete Type ame Capacity ECH Thia Prvinen as S304601 1700 CB ESI Tni r 2554036007 14500 GE This message appears if there is no more room for new iSCSI target creation Space Allocation X Not enough fre space to alocata Tt takes at least GB free space to slincate 1C STIL SB volume Each RAID volume can only create one iSCSI thin provision volume Each thin
121. n Interface you can configure the network settings of the Thecus IP storage for your network You can access the Network menu from the menu bar For details on how to configure your network settings refer to Chapter 4 System Network Step 2 RAID Creation Next administrators can configure their preferred RAID setting and build their RAID volume You can access RAID settings from the menu bar of the Web Administration Interface by navigating to Storage Management RAID Configuration For more information on configuring RAID see Chapter 4 System Management RAID Configuration Don t know which RAID level to use Find out more about the different RAID levels from Appendix B RAID Basics Step 3 Create Local Users or Setup Authentication Once the RAID is ready you can begin to create local users for Thecus IP storage or choose to setup authentication protocols such as Active Directory AD For more on managing users go to Chapter 4 User and Group Authentication For more information on configuring Active Directory see Chapter 4 User and Group Authentication ADS NT Support For information about the benefits of Active Directory see Appendix C Active Directory Basics Step 4 Create Folders and Set Up ACLs Once users are introduced into your network you can begin to create various folders on the Thecus IP storage and control user access to each using Folder Access Control Lists More information on managing f
122. nable 9 Disable ty Tire s Manufacture WF Modei v L7 means tha proouct has Deen tested for Compatibility j Battery Status ILA Power WA Saconds batween power fadure and first notification Seconds between subsequence power falure notifications is t An i Shutdown the system when the battery charge i less than 1H p a a sia k aa User and Group Authenticato Teele 2 use See the following table for a detailed description of each item UPS Setting tem X X BDescipion J Model Choose the UPS model number from the dropdowns Battery Status Current status of the UPS battery UPS first notification seconds failure notifications Shutdown the system when the Amount of UPS battery remaining before system battery charge is less than should auto shutdown Apply Press Apply to save your changes Schedule Power On Off Using the Thecus IP storage System Management you can save energy and money by scheduling the Thecus IP storage to turn itself on and off during certain times of the day From the menu choose the Schedule Power On Off item and the Schedule Power On Off screen appears To designate a schedule for the Thecus IP storage to turn on and off first enable the feature by checking the Enable Schedule Power On Off checkbox Then simply choose an on and off time for each day of the week that you would like to designate a schedule by using the various dropdowns Finally c
123. ndy Weekly Report CJ AMD Thecus 01 Besttech GT _J ACS xxx 1 AMCC Thecus 02 iso Adobe Acrobat 7 0 Pro ATOM Andy Private naswebsite Thecus 01 naswebsite Thecus 01 iso 102 8MB K 4 Page ofi gt D Displaying iso mount information 1 1 of 1 File Selected Mount as Description Only ISO 9660 file system can be mounted Top 50 Folders Add Top 50 Files Please tvpe in the full path of the ISO 1f not listed You could click Unmount to eliminate mounted ISO file B Using ISO The mounted ISO file will be located same share folder with name giving Please refer the screen shot below ISO file image has mounted as folder Image you could see The ISO file Thecus 01 without assign mounting name system automatically has folder Thecus 01 created L naswebsite izhS N5200 NEWUI 172 16 66 40 EG REQ RH RBE IAD BAD ae Q a 3 y 7 OF RAR POLED 2 172 16 66 40 naswebsite 8 IESEB PHOT A at ACS 6xxx et Adobe Acrobat 7 0 Pro M AMCC D Rae ETA u e TEE T CIS RSS Ph SB cJ AMD isl Andy Private J Andy Weekly Report ES ITUR i 3 Besttech GT ml BT Seed x N5200 NEWUI 172 16 66 40 Thecus Ol SCRA SSS we EE D RAH HSI Ge HRS LAM Thecus 02 Es JCURRRIS S SE et A AE AA k 105 290 KE A 109 290 KE FAEH Y User and Group Authentication The Thecus IP storage has built in user database that allows administrators to
124. ng click Cancel Cancel 127 14 When the upload is finished the Wizard will ask you whether if you want to go to the website Click Finish to go to your Photo Web Server Web Publishing Wizard E Completing the Web Publishing Wizard Y ou have successfully published your files to this site Open this site when click Finish To close this wizard click Finish 15 Click on the user s icon to go to that user s album bs i Thecus Creator in Storage mer Photos andy s altum TS iT 4 4 ay Protect Your Source Secure v Data 16 You will see the user s album list Click on Album 128 ir ics Thecus Creator in Storage Z a NAZDI V3 n4 n Phaobas gt andy s album Protect Your Source Secure v Data 17 Finished You will see the pictures just selected in the album ir Durus Crier in Sinaga a Lice wer tes ao POS gt ah a aU gt Son Protect ur source Secure v Data Managing Albums and Photos Icon Function Description Make Cover Make selected photo your cover picture Back Return to the previous screen 129 Add Add a new album or photos Modify Edit the name and description of the selected album or photo Each name is limited to 20 characters and each description is limited to 255 characters Delete Delete the selected albums or photos e Only logged in users will see these icons e To prevent system errors Thecus IP storage sets
125. ntaining user names passwords and group names separated by comma without any space each line represents ane user ex Studentl passwordl student group Application Server The Thecus IP storage supports printer server and Tunes server The integrated Print Server allows you to share a single USB printer will all users on the network The Thecus IP storage provides activating the iTunes Server on the device You will be able to play music files on this device with your iTunes client software directly The following section shows you how Printer Information From the Application Server menu choose the Printer item and the Printer Information screen appears This screen provides the following information about the USB printer connected to the USB port 107 Menu My favanite d System Information Printer Information p d 5ystem Management f Printer 1 E System Mebwark i 1 Storage eee icm Model nA NT La 3 PATRE crete aO User and Graup Authenticatio Statue Na Printer Datactad Remove document m L from queue eo Restart printer service Printer Information Item X Descipio Displays the name of the USB printer manufacturer Displays the model of the USB printer Status Displays the status of the USB printer Remove document Click to remove all documents from printer queue from Queue Restart Printer service Click to restart printer service If a corrupt print job is
126. olders see Chapter 4 Storage Management Share Folder To find out about configuring Folder Access Control Lists see Chapter 4 Storage Management Share Folder Folder Access Control List ACL Step 5 Start Services Finally you can start to setup the different services of Thecus IP storage for the users on your network You can find out more about each of these services by clicking below 35 SMB CIFS Apple File Protocol AFP Network File System NFS File Transfer Protocol FTP iTunes Server Printer Server Photo Server 36 Chapter 4 System Administration Overview The Thecus IP storage provides an easily accessible Web Administration Interface With it you can configure and monitor the Thecus IP storage anywhere on the network Web Administration Interface Make sure your network is connected to the Internet To access Thecus IP storage Web Administration Interface 1 Typethe Thecus IP storage IP address into your browser Default IP address is http 192 168 1 100 Ld it Thecus Creator in Storag wwe heds com Protect vour source Secure vou Data Your computer s network IP address must be on the same subnet as the Thecus IP storage If the Thecus IP storage has default IP address of 192 168 1 100 your managing PC IP address must be 192 168 1 x where x is a number between 1 and 254 but not 100 2 Login to the system using the administrator user name and password The fa
127. on of the operating system on which the executable runs unless that component itself accompanies the executable If distribution of executable or object code is made by offering access to copy from a designated place then offering equivalent access to copy the source code from the same place counts as distribution of the source code even though third parties are not compelled to copy the source along with the object code 151 You may not copy modify sublicense or distribute the Program except as expressly provided under this License Any attempt otherwise to copy modify sublicense or distribute the Program is void and will automatically terminate your rights under this License However parties who have received copies or rights from you under this License will not have their licenses terminated so long as such parties remain in full compliance You are not required to accept this License since you have not signed it However nothing else grants you permission to modify or distribute the Program or its derivative works These actions are prohibited by law if you do not accept this License Therefore by modifying or distributing the Program or any work based on the Program you indicate your acceptance of this License to do so and all its terms and conditions for copying distributing or modifying the Program or works based on it Each time you redistribute the Program or any work based on the Program the recipient automatic
128. onfirme OR Description The iSCSI block size can be set under system advance option defauk s 512 Bytes Please use 4K block sve whie more than 2TB capacity wil be configured in Windows XP Please use 512 Bytes block sre for application lke VMware etc Create iSCSI Volume Item Description 1 o O RAID ID ID of current RAID volume Allocation Percentage and amount of space allocated to iSCSI volume volume Target Name Name of the iSCSI Target This name will be used by the Teeme Stackaple NAS funcion to deny tis export shares Authentication You may choose CHAP authentication or choose None Select the current month from the dropdown 76 LUN ID Specific Logic unit ID number Enter a password Password Confirm Reenter the chosen password 2 Designate the percentage to be allocated from the Allocation drag bar 3 Enable the iSCSI Target Service by selecting Enable 4 Choose to enable CHAP authentication or choose None 5 Enter a Target Name This will be used by the Stackable NAS function to identify this export share 6 Choose the current year from the Year dropdown 7 Choose the current month from the Month dropdown 8 WheniSCSI target volume has been created the LUN ID is configurable from 1 to 254 with a default of the next available number in ascending numerical order The LUN ID is unique and can not be duplicated except for LUN ID O 9 If you ve enabled CHAP authenti
129. onjour locates devices such as printers as well as other computers and the services that those devices offer on a local network using multicast Domain Name System service records This definitive guide walks you through Bonjour zero configuration networking with a complete description of the protocols and technologies used to create Bonjour enabled applications and devices E System Information Bonjour Setting Se System Management Bonjour service Enable i Diable int System Network HFS e TFTP Thecus IP storage can act as a TFTP server enabling users to download and upload files with their favorite TFTP programs From the System Network menu choose the TFTP item and the TFTP screen appears You can change any of these items and press Apply to confirm your settings 60 Menu E System Information TFTP System Management TFTP C Enable amp Disable ig System Network z P FI Wan 192 158 0 5 F eerie A V LAN 192 1 g P Media Server PA HTTP Web Disk Port et UPnP Share Foker d E Nsync Target The folder e not found among the iet f Bonjour J Folder Permission C Read us r3 i ra F Cn e i rie Storage Hagl aa User and Group Authentication zi A description of each item follows FTP Item Description o TFTP Enable TFTP Service on the Thecus IP storage Checked WAN LAN1 or LAN2 to enable port use m E Reni eine Eee
130. oup select the user from Members List and press the button 5 Click the Apply button to save your changes Edit x Local Group Setting Users List Group Name Search Group ID UserID User Name 00 User Members List UserID User Name Remove Groups 1 On the Local Group Configuration screen select a group name from the list 2 Press Remove to delete the group from the system Local Group Configuration QU ud Cp Edit J Remove Group ID Group Name Group Local Group Setting x 9 Do you want delete this group in dJ 106 Batch Create Users and Groups The Thecus IP storage can also add users and groups in batch mode This enables you to conveniently add numerous users and groups automatically by importing a simple comma separated plain text txt file From the Accounts menu click Batch Mgmt and the Batch Create Users and Groups dialogue will appear To import your list of users and groups follow these steps 1 Click Browse to locate your comma separated text file The information in the text file should follow this format USERNAME PASSWORD GROUP 2 Click Open 3 Click Import to begin the user list import dc System Information Batch Create Users and Groups p system Management E System Network agn User and Group Authentication n ame TOD rad FE patch Input Description Create lacal users and groups in batch moda Submit files co
131. oup or user from an access level column press the Remove button in that column When you are finished press Apply to confirm your ACL settings If one user has belonged to more than one group but different privilege than the priority Deny gt Read Only gt Writable To setup sub folders ACL click on symbol to extract sub folders list as screen shot shows below You may carry on with same steps as share level ACL setting 90 Folder Qaa ear QRamove Dmm Css Bact Folder name b eame D usbndd D L usbcopry b E nasvebite b Tunes russe b tant Aa C tasti b EQECK b LJ NatBenck NOTE RAID ID aaga aaa aaa aaas aas aaga File System exti ex ext ax ex ext exta Public Description na naync yes uzbhdd no usbcopy na nas website yes iW unes Music yes no na Ag The ACL can be set for share and sub folders level not for files The ACL screen also allows you to search for a particular user To do this follow the steps below 1 In the blank enter the name of the user you would like to find 2 From the drop down select the group you would like to search for the user in 3 Click Search Local Groups W jh Search Local Users Local Groups Local Users The system will list up to 1 000 users from the chosen category To narrow your search enter a search term in the blank provided 91 Stackable NAS The Thecus IP storage s capacity can be e
132. pending on manufacturer in power on state Temperature Celsius The current temperature of the hard disk in degrees Celsius Reallocated Sector Count of reallocated sectors When the hard drive finds a 62 read write verification error it marks this sector as reallocated and transfers data to a special reserved area spare area This process is also known as remapping and reallocated sectors are called remaps This is why on a modern hard disks you can not see bad blocks while testing the surface all bad blocks are hidden in reallocated sectors However the more sectors that are reallocated the more a decrease up to 10 or more can be noticed in disk read write speeds Current Pending Sector Current count of unstable sectors waiting for remapping The raw value of this attribute indicates the total number of sectors waiting for remapping Later when some of these sectors are read successfully the value is decreased If errors still occur when reading sectors the hard drive will try to restore the data transfer it to the reserved disk area spare area and mark this sector as remapped If this attribute value remains at zero it indicates that the quality of the corresponding surface area is low Test Type Set short or long time to test Test Result Result of the test Total time of the test If the Reallocated Sector Count gt 32 or Current Pending Sector of a hard disk drive gt 0 the status of t
133. ponsible for any damage or loss of data deemed to be caused by its products It is highly recommended that users conduct necessary back up practices Safety Warnings For your safety please read and follow the following safety warnings HN PN P b Read this manual thoroughly before attempting to set up your Thecus IP storage Your Thecus IP storage is a complicated electronic device DO NOT attempt to repair it under any circumstances In the case of malfunction turn off the power immediately and have it repaired at a qualified service center Contact your vendor for details DO NOT allow anything to rest on the power cord and DO NOT place the power cord in an area where it can be stepped on Carefully place connecting cables to avoid stepping or tripping on them Your Thecus IP storage can operate normally under temperatures between 5 C and 40 C with relative humidity of 20 85 Using Thecus IP storage under extreme environmental conditions could damage the unit Ensure that the Thecus IP storage is provided with the correct supply voltage AC 100V 240V 50 60 Hz 3A Plugging the Thecus IP storage to an incorrect power source could damage the unit Do NOT expose Thecus IP storage to dampness dust or corrosive liquids Do NOT place Thecus IP storage on any uneven surfaces DO NOT place Thecus IP storage in direct sunlight or expose it to other heat sources DO NOT use chemicals or aerosols to clean Thecus IP storag
134. pply to change WARNING If an NTP server is selected please make sure your Thecus IP storage has been setup to access the NTP server Notification configuration From the menu choose the Notification item and the Notification Configuration screen appears This screen lets you have Thecus IP storage notify you in case of any system malfunction Press Apply to confirm all settings See following table for a detailed description of each item My favorite Q Reboot amp Shutdown ro Eum i Recewer s Etal Address 3 Recawer s E Mail Address 4 TM System Information i Notification Configuration p 4 System Management Beep Hatfication i Enable C Diable Email Notification C2 Enable Disable amp Firmware Upgrade SMTP Server pone rt a SIAE Schedule n Ol HI Auth Type hr i roa GU wake Up on LAN SMTP Account ID m SNMP Account Password a uic si E Mail From f Admnistrator Password E Config Marri Recewer 5 Etal Address 1 E ri rmi ed i a Factory Deraut Receiver s E Mail Address 2 45 Notification Configuration Item Description o Beep Notification Enable or disable the system beeper that beeps when a problem occurs Email Notification Enable or disable email notifications of system problems Receiver s E mail Add one or more recipient s email addresses to receive email Address 1 2 3 4 notifications Consult with your mail server administrator for email ser
135. rently allocated 63 Menu E My favorite E System Information j RAID Information System Management E System Network RAID Status Disks Tota Dat SCS Lava mui Usad Capacty apacty Cana Ed Storage ludi Hiakh 1 2 3722 2 0 2 GB 3424 4 GB 37 2 mo RAI u Healthy B ar22 2 OO DB 3720 5 GB WA Eista e Discs Durused RAID Information Item Description O volume NOTE All RAID IDs must be unique Status Indicates status of the RAID Can read either Healthy Degraded or Damaged iSCSI Capacity Create a RAID On the RAID Information screen press the create button to go to the CREAT RAID screen In addition to RAID disk information and status this screen lets you make RAID configuration settings Using Create RAID you can select stripe size choose which disks are RAID disks or the Spare Disk RAID Configurations Item Master RAID Stripe Size This sets the stripe size to maximize performance of sequential files in a storage volume Keep the 64K setting unless you require a special file storage layout in the storage volume A larger stripe size is better for large files The percentage of the RAID volume that will be used to store data Create Press this button to configure a file system and create the RAID storage volume 64 To create a RAID volume follow the steps below 1 On the RAID Information screen click create 2 On the RAID Configuration screen set
136. rently inaccessible e Solid green network link e Blinking green network activity e Solid green network link e Blinking green network activity e Solid blue files are being copied from a USB storage device e Solid blue external eSATA device has connected e USB 2 0 port for compatible USB devices such as USB disks 1 Power LED 2 System LED 3 WAN LAN1 LED 4 LAN2 LED 5 USB Copy LED 6 eSATA link LED 7 USB Port 8 Power Button 9 Up Button A 10 Down Button W 11 Enter Button 4 12 Escape Button ESC 13 LCD Display 14 HDD Trays e Power on off N7700 e Push to scroll up when using the LCD display e Push to enter USB copy operation screen e Push to enter LCD operate password for basic system setting e Push to leave the current LCD menu e Displays current system status and warning messages e Seven 3 5 SATA HDD trays e Locks are provided for added security 13 1U4600 The Thecus 1U4600 front panel has the device s controls indicators and hard disk trays Escape Button PWR LED Down Button LAN2 LED Power Button Busy LED WAN LAN1 LED Reset Button Up Button USB Port LCD Display Enter Button Busy LED Front Panel Item Description O WAN LAN1 LED e Solid green network link e Blinking green network activity LAN2 LED e Solid green network link e Blinking green network activity currently inaccessible USB disks and USB printers Power Button e Power on off 1U4600 e Solid blue Dev
137. rformance A RAID system accesses several hard disks simultaneously which improves I O performance over a single hard disk Data security is enhanced by a RAID since data loss due to a hard disk failure is minimized by regenerating redundant data from the other RAID hard disks Benefits RAID improves I O performance and increases data security through fault tolerance and redundant data storage Improved Performance RAID provides access to several hard disk drives simultaneously which greatly increases I O performance Data Security Hard disk drive failure unfortunately is a common occurrence A RAID helps prevent against the loss of data due to hard disk failure A RAID offers additional hard disk drives that can avert data loss from a hard disk drive failure If a hard drive fails the RAID volume can regenerate data from the data and parity stored on its other hard disk drives RAID Levels The Thecus IP storage supports standard RAID levels 0 1 5 6 10 and JBOD You choose a RAID level when you create a system volume The factors for selecting a RAID level are e Your requirements for performance e Your need for data security e Number of hard disk drives in the system capacity of hard disk drives in the system The following is a description of each RAID level RAID O RAID O0 is best suited for applications that need high bandwidth but do not require a high level of data security The RAID O0 level provides the bes
138. rinters usb printer in the box where lt Thecus NAS IP is the IP address of Thecus IP storage Click Next 110 6 Select or install a printer and then press OK Bax Select the manufacturer and model of your printer If your printer came with an installation disk click Have Disk If your printer is not listed consult your printer documentation for a compatible printer Printers Sw HP DeskJet 615C EF HP DeskJet 640C 542C 548C EF HP Deskjet 6500 Series EF UP ned let enne em If your printer model is not listed please contact your printer manufacturer for help 7 Windows will attempt to connect to the printer Connecting to http 172 16 66 64 631 printers usb printer 8 You can choose to set this printer as the default printer by checking the Set as the default printer box Click Next to continue Type a printer name Printer name l usb printer on http 172 16 66 64 631 V Setas the default printer This printer has been installed with the HP Deskjet 6500 Series driver 111 9 Done Click Finish w a Add Printer You ve successfully added usb printer on http 172 16 66 64 631 To see if the printer is working correctly or to see troubleshooting information for the printer print a test page Print a test page iT unes Server With the built in iTunes server capability Thecus IP storage enables digital music to be shared and played anywhere on the network From the
139. rmmare Version 3 02 01 18 minutes Item j Descrption O Displays the name of the system manufacturer Product No Shows the model number of the system Shows the current firmware version Displays the total run time of the system System Service Status From the Status menu choose the System item System Status and Service Status screens appear These screens provide basic system and service status information 41 H System Infonmaden System Status 4 En d CPU Loading Y Dos Je 0ST t Logs CPU Fan Speed ORK ff On ine Reg System Fan 1 5peed OK Up Trne i hour 15 minutes Service Status AFP Status Stop NFS Statue Stop SMB CIS Status Running FTP Status Stop TFTP Status Stop Hadia Server Stop Hsymc Status Stop UPnP Status stor x System Management Status TEHE SKHMFP Stop m System Network EN System Status Displays current CPU workload of the Thecus IP storage Displays current CPU fan status Displays the current status of the system fan Shows how long the system has been up and running CPU Loading CPU Fan Speed System Fan Speed Up Time Item Description Logs From the System Information menu choose the Logs item and the System Logs screen appears This screen shows a history of system usage and important events such as disk status network information and system booting See the following table for a
140. s Setup Change Password Complete PREV NEXT END 6 Name your Thecus IP storage and configure the network IP address If your switch or router is configured as a DHCP Server configuring the Thecus IP storage to automatically obtain an IP address is recommended You may also use a static IP address and enter the DNS Server address manually Thecus Setup Wizard 2 Network Configuration Version 1 1 98 Device HostName N7700 Discovery Login System 172 16 66 70 veces 255 255 255 0 Configuration 172 16 66 1 Change Password Complete 7 Change the default administrator password Thecus Setup Wizard m Change Password Version 1 2 0 4 Device Discovery Login System A Network Configuration Change Password X Complete PREV APPLY 8 Finished Access the Thecus IP storage Web Administrator Interface by pressing the Start Browser button You can also configure another Thecus IP storage at this point by clicking the Setup Other Device button Press Exit to exit the wizard 30 Thecus Setup Wizard 2 Complete Version 1 2 0 X Device Discovery Login System Setup Uther Device Start Browser A Network Configuration 49 Change Password Complete The Thecus Setup Wizard is designed for installation on systems running Windows XP 2000 vista 7 or Mac OSX or later Users with other operating systems wil
141. s and delete files in the folder 6 To create a new folder within the current folder press the New folder button When the screen appears enter a name for the folder Press OK to create the folder 7 To upload a file from your computer to the current folder press the New file upload button When the screen appears press Browse and locate the file to upload Press OK and the file is uploaded to the current folder 8 To delete a file or folder select the file or folder s check box Press the Delete selected items button You can also check the check box as the red circle indicates to select all files and folders in this folder To access folders with access control you must first login with a local user account For more information on how to setup user rights to the folders please check Chapter 4 Storage Management Share Folder Folder Access Control List ACL ewe E9 Web Disk Directory Tree 45 Browsing Directory naswebsite F n Ha Home S Relesd CL search da 5b 9 Fiter a ngync a 7 usbeopy mm iu rase 3i Sj usbhdd Page ofi Dane No items to display Home amp Reload 3 Search a X a Y 9a Show Directories Filter Folder Page Button Directory Tree us List all directory trees per login user s privilege Browsieqrtileeciaey Browsing selected directory of its folders and files Go back to the web disk directory layer Re load the current list Search Search files in the current we
142. s complete If you find that some items are missing contact your dealer Front Panel NO503 The Thecus N0503 s front panel has the device s controls indicators and hard disk trays HEN TTL ULL Mz iN adi i A N Pa lt 3 v i N go 1 x s 1 1 zai n90000 E z pann I O Ml 1 MUU aie 2 Dyk UUM nh nts gog bs i JJ n cad db e NA I3 o06060002009c Front Panel Item Description O O OZ 1 10 0 Power LED e Solid blue system is powered on e Solid green network link e Blinking orange network activity e Solid green network link e Blinking orange network activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity e Solid red HDD failed e Blinking orange HDD activity USB Port e USB 2 0 port for compatible USB devices such as digital cameras USB disks USB printers and USB wireless dongles Note For supported USB wireless dongles please contact Support thecus com Power Button e Power on off N0503 10 o Solid blue Device is powered on LCD Display e Displays current system status and messages Update time 60 seconds Down Button W e Push to scroll DOWN when using the LCD display Up Button A e Push to scroll UP when using the
143. s set to Yes all users will be able to access it and ACL button will be grayed out If Public is set to No the ACL button will be available on the Stack Target List window Add iSCSI Target Add Stack Target X Enable iSCSI Target C Enable Q Disable stackable Target IP 172 16 653 157 ign 19n 2009 05 com thecus AFS iscs0 vel iscsi x Username Password Export share name Limit 0 9 2 2 Description Browseable B ves no Click Apply to save your changes B Activate a Stack Target After your settings have been applied the system will bring you back to Stack Target List window as shown below There is one stack target device has been attached into this stack master Stack Target List Add ds Edit Remove 7 Fi Reconnect Export share name IP Capacity Used Total Status Description ign ici 172 1665157 0GB 0 1GB Disable ign 2009 05 cor 95 Success x i You have successfully formatted stack folder iscsi With this newly attached stack target device you will see the information displayed and also several options you can choose In general if attached stack target device has been used by another N5200PRO 1U4500 N5500 N8800 N8800 N8800 as stack target volume then the Format item will be display and system will recognize it straight away and display its capacity Otherwise the Format item will be available and the Capacity and Status items will show as N A and Unknown file system
144. sent to a printer printing may suddenly fail If your print jobs seem to be locked up pressing the Remove All Documents button to clear the print queue may resolve the issue You can configure Thecus IP storage to act as a printer server That way all PCs connected to the network can utilize the same printer Windows XP SP2 To set up the Printer Server in Windows XP SP2 follow the steps below 1 Connect the USB printer to one of the USB ports preferably the rear USB ports front USB ports can be used for external HDD enclosures 2 Goto Start Printers and Faxes 3 Click on File Add Printer 4 The Add Printer Wizard appears on your screen Click Next 5 Select the A network printer or a printer attached to another computer option 6 Select Connect to a printer on the Internet or on a home or office network and enter http Thecus IP storage IP ADDRESS 631 printers usb printer into the URL field 7 Your Windows system will ask you to install drivers for your printer Select correct driver for your printer 8 Your Windows system will ask you if you want to set this printer as Default Printer Select Yes and all your print jobs will be submitted to this printer by default Click Next 9 Click Finish 108 Windows Vista e Not all USB printers are supported Please check Thecus website for a list of supported printers e Note that if a multi function all in one printer is attached to the Thecus
145. ser to designate often used items and have them display on the main screen area The figure below displays 12 default favorite functions Thecus Creator in Storage weave ihecur com Beer Tem Pirie 1 dus n E abus Li Lois ici Fef e e i Hobert i P DS ia A 2 md 1 NM ef cherie Onjoff WAN FTE Disks AA Space Alocatian Shand Poker Liar EET uj recte Nanwork s RS SELEG E Leer m amp utFertcida 7 73 seplizater Sore B Mode management I BS Backup Administrators can add or remove favorite functions to My Favorites by right clicking System Information zl the mouse on the menu tree E info The other way administrators j e Bes myer can add favorite functions is by clicking the Add Favorite r My favorite icon in each function screen exa Management i Please refer figure below in red fs aa aa EN circuit Icon zt 3 Storage To return to the favorite aa User and Group Authentication screen simply click My ETT schedule On off Favorite located at the left iaeia serer OOOO O hand corner of the main screen 38 Ie Dy favonte Setting system time Date ID1 29 010 Time 21 44 w Lal Menu Bar The Menu Bar is where you will find all of the information screens and system settings of Thecus IP storage The various settings are placed in the following groups on the menu bar d System Information
146. sts heat from the unit 7 Power Connector e Connect the included power cords to these connectors 8 USB Port e USB 2 0 port to connect PC Type B of target mode 19 N7700 series The N7700 rear panel features ports and connectors p ma M 3 TEI D estie e202000 N amp 2 j mi Back Panel Item Description or router switch or router 3 Serial Port e This port is for external UPS device 4 eSATA Port e eSATA port for high speed storage expansion 5 USB Port e USB 2 0 port for compatible USB devices such as USB disks and USB printers 6 System Fan e System fan that exhausts heat from the unit 7 Power Connector e Connect the included power cords to these connectors 20 1U4600R The rear panel of the 1U4600R houses most of the USB and Ethernet connections as well as the eSATA port system fan and power connector See the table below for descriptions of each Power Connector Power Connector Power Switch Power Switch USB Ports A Type LAN2 Port Power LED Power LED System Fan eSATA Port Serial Port USB Ports B Type WAN LAN1 Port 1U4600 Back Panel Item Description A4 A9 O eSATA Port e eSATA port for high speed storage expansion cameras USB disks and USB printers switch or router e System fan that exhausts heat from the unit 1U4600S The rear panel of the 1U4600S is similar to the 1U4600R but with a
147. such claims this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system it is up to the author donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License If the distribution and or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries so that distribution is permitted only in or among countries not thus excluded In such case this License incorporates the limitation as if written in the body of this License 152 9 The Free Software Foundation may publish revised and or new versions of the 10 11 12 General Public License from time to time Such new versions will be similar in spirit to the present version but may differ in detail to address new problems or concerns Each version is given a distinguishing version number If the Program specifies a version number of this License which applies to i
148. sults will be shown at the bottom Status Latest 20 lines Information 14 14 1i 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 ntiguous to E B HE pP Hp pP Pee 6 C C WDA HHH HH Ci H c C oO oO Checking group summary inform n Eod Reit head unb In we Co h p Oo mw ro O D rob rmm cr co co aa AnH amp 6 O m bes no n Q Qi ooo in amp in A Mord eil Mn ed ee S05 er oo O Ed be D O 2 M D iD L LO D tO LD WD D t e m be be 2 amp n Q iQ in iQ iQ i i in y qi iQ y ii i o y ted e Oy Cn hm C fo Oo k e HW oO te y s mow D fb D D D rp rb co ro ro C amp C 6 amp amp mM OH amp eO m v vg0O0 sysiv 144 fi 3 05 non 44 blocks J Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Co Oy Co Co CO CO Co Co Co Co Co Co o Co Co Co Co Co Co Co Co Co GI Bad unt mt and ed ted f f I L r f L L ron roy Le ti Le r Le ror Leu r Le 200 f Pat ran lt u ron Le pie Le r Le m Q FO fb b pop pO p po po jo co te roo in in on ii in on eo ov D M c Result AID 1 2 3 4 5 System Volume i 0 T al v E L a See Pe 3 52 The system must be rebooted before Thecus IP storage can function normally after file system check complete System Network Use the System Network menu to mak
149. t RAID 5 Ori RAID 1 gt RAID D Ghina RAID amp RAD 6 tOrfine RAID 1 RAIS nme Ase RAID Configuration x Warning RAID migration may take several hours to complete depending on the RAID capacity Are you sure RAID Configuration x To avoid disaster data lost caused by power failure a full data backup is strongly recommanded Please type in Yes below to proceed RAID Configuration x RAID Setting Successfully You are in on line Migration NOW Migrating a RAID volume could take several hours to complete With RAID level migration function it has two different type On line and Off line alone with limitation as listed below 1 During RAID level migration it is not allowed reboot or shutdown system 2 Off line RAID level migration all services will stop and data is inaccessible 3 To have ZFS file system created doing on line RAID level migration from R1 to R5 or R1 to R6 the all services will restart and volumes user data and iSCSI are read only during operation 4 To have ext3 and XFS file system created doing on line RAID level migration from R1 to R5 or R1 to R6 the all services will restart and volumes iSCSI is read only but user data is capable read write during operation 72 5 The other combination to make as On line can have read write work as normal The migration scheme below is based on Thecus Thecus I
150. t and any later version you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation If the Program does not specify a version number of this License you may choose any version ever published by the Free Software Foundation If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different write to the author to ask for permission For software which is copyrighted by the Free Software Foundation write to the Free Software Foundation we sometimes make exceptions for this Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally NO WARRANTY BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE THERE IS NO WARRANTY FOR THE PROGRAM TO THE EXTENT PERMITTED BY APPLICABLE LAW EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND OR OTHER PARTIES PROVIDE THE PROGRAM AS IS WITHOUT WARRANTY OF ANY KIND EITHER EXPRESSED OR IMPLIED INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU SHOULD THE PROGRAM PROVE DEFECTIVE YOU ASSUME THE COST OF ALL NECESSARY SERVICING REPAIR OR CORRECTION IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN W
151. t performance of all the RAID levels but it does not provide data redundancy RAID O uses disk striping and breaking up data into blocks to write across all hard drives in the volume The system can then use multiple hard drives for faster read and write The stripe size parameter that was set when the RAID was created determines the size of each block No parity calculations complicate the write operation RAID 1 RAID 1 mirrors all data from one hard disk drive to a second one hard disk drive thus providing complete data redundancy However the cost of data storage capacity is doubled 144 This is excellent for complete data security RAID 5 RAID 5 offers data security and it is best suited for networks that perform many small I O transactions at the same time as well as applications that require data security such as office automation and online customer service Use it also for applications with high read requests but low write requests RAID 5 includes disk striping at the byte level and parity information is written to several hard disk drives If a hard disk fails the system uses parity stored on each of the other hard disks to recreate all missing information RAID 6 RAID 6 is essentially an extension of RAID level 5 which allows for additional fault tolerance by using a second independent distributed parity scheme dual parity Data is striped on a block level across a set of drives just like in RAID 5 and a second set
152. tal music photos or files by simply using their web browsers To manage your personal files or access public files on the Thecus IP storage just enter its IP address into your browser default IP address is http 192 168 1 100 and you will be taken to the Thecus IP storage Login page Before proceeding make sure that WebDisk Support or Secure WebDisk Support is enabled in the Service Support screen in the system s Network menu See Service Support in Chapter 4 System Network gt HTTP Web Disk Login Page To login to the system enter your user name and password and select Web Disk or Photo server then click Login to log into the system You will be taken to the selected interface s Thecus Creator in Storage www heus ogm Protect vou Source Secure vor Data Using WebDisk The Thecus IP storage provides a WebDisk function that allows you to access the system over the Internet from any browser 1 In the Login page type in the User ID and password that were previously set for you in the Accounts menu See Chapter 4 User and Group Authentication Local User Configuration 2 The WebDisk page appears showing folders made currently available to you via the Access Control List ACL 3 Click on a folder name to enter the folder 4 The folder s page appears displaying files and folders Click on a file to download the file 121 5 Buttons on the folder page allow you to create a new folder upload file
153. the following limitations on photo files e Each file upload is limited to a size of 8MB Files exceeding 8MB will NOT be uploaded and no error message will appear e Only these photo file types will be uploaded jpg gif bmp png pcx psd bmp e If duplicate file names exist during upload process system will add a number in front of the original file name abc gt 1abc Creating Albums To create a photo album follow the steps below 1 Click the Add button to create a new album 2 Enter a name for the album and enter a description if you wish Then click on the Create Album button Password Protecting Albums If you would like to put a password on a particular album follow these steps 1 Select the album to be protected click on the Edit button and the Album Edit screen will appear 2 The owner of the album can enter an album password to protect the album so that only people with the correct password can view the album Uploading Pictures to Albums Uploading pictures to albums using the Web User Interface is easy 1 When the album is created click the album icon to enter the album Initially the album is empty 2 Click the Add button to upload pictures into the album The Upload Photos screen will appear Users can select and upload up to 8 pictures at a time 3 Oncethe picture is uploaded you can view it in the album The owner of the album can delete or modify the pictures with the Delete or
154. tion OO Disk No Indicates disk location Capacity Shows the SATA hard disk capacity Displays the SATA hard disk model name Shows the SATA hard disk firmware version Indicates the status of the disk Can read OK Warning or Failed Bad Block scan Yes to start scan Bad Block Total Capacity Shows the total SATA hard disk capacity Disk Power The administrator can set the disk to power down after a period of Management inactivity When the Status shows Warning it usually means there are bad sectors on the hard disk It is shown only as a precaution and you should consider changing the drives S M A R T Information On the Disks Information screen the status of each disk will be displayed in the Status column Clicking on an OK or Warning link will display the S M A R T Information window for that particular disk You may also perform disk SMART test simply to click Test to start with The result is only for reference and system will not take any action from its result SMART INFO X Temperature Celsius 35 Reallacated Sector Count Current Panding Sector Test Test Tune short long ast Type Test Result Click to start Teast Time S M A R T Information Item Description o Z Model name of the installed hard disk Power ON Hours Count of hours in power on state The raw value of this attribute shows total count of hours or minutes or seconds de
155. to this share root root t t t will be n to anonyt aser m 1ogrou I All User on guest system will be mapped to anonymous user nobody nogroup on NAS NFS Share Item Description O 1 0 Enter the name or IP address of the host Host has either read only or writeable access to the folder Guest System Support There are two selections available Unix Linux System e AIX Allow source port gt 1024 Choose the one which best fits your needs IO Mapping There are three selections available 87 Guest system root account will have full access to this share root root Guest system root account will be mapped to anonymous user nobody nogroup on NAS All user on guest system will be mapped to anonymous user nobody nogroup on NAS Choose the one which best fits your needs Apply Click to save your changes Snapshot The Thecus IP storage is capable for 16 snapshot version control To have snapshot to work on the file system creation for RAID volume has to be ZFS Folder Q Add Edit Remove La NFS Lg Snapshot Folder name RAID ID File System Public Description nsvnc RAIDI ext3 no nsync usbhdd RAIDI ext3 no usbhdd usbcopy RAIDI ext3 no usbcopy _ naswebsite RAIDI ext3 ves naswebsite iTunes music RAIDI ext3 yes ilIunes music J BONNY RAIDI ext3 yes Snap Snapshot configuration If added folder has located in the RAID volume with ZFS file system
156. us FTP users to upload or Access download files to from public folders Download Allow anonymous FTP users to download files from public folders No access Block anonymous FTP user access Auto Rename If checked the system will automatically rename files that are uploaded with a duplicate file name The renaming scheme is filename where represents an integer Upload Bandwidth You may set the maximum bandwidth allocated to file uploads Selections include Unlimited 1 2 4 8 16 and 32 MB s Download Bandwidth You may set the maximum bandwidth allocated to file downloads Selections include Unlimited 1 2 4 8 16 and 32 MB s To access the share folder on Thecus IP storage use the appropriate user login and password set up on the Users page Access control to each share folder is set up on the ACL page Storage Management gt Shore Folder gt ACL 58 HTTP Web Disk From the System Network menu choose the HTTP Web Disk item and the Web Disk HTTP Support screen appears This screen displays the service support parameters of the system You can change any of these items and press Apply to confirm your settings d Ei Myr Bronie System Information r WebDisk HTTP Support System Management Cy Disable Dota Hebwark D PE E Meymc Target i Bonjour E Storage Apply man User and Group Authenticaton A description of each item follows Web Service
157. ver information Firmware Upgrade From the menu choose the Firmware Upgrade item and the Firmware Upgrade screen appears Menu E m E esteem Information Firmware Upgrade 5pstem Management A System Management Frrrerares Select 1 fima E fi 3 A VS ae o Appi Follow the steps below to upgrade your firmware 1 Use the Browse button to find the firmware file 2 Press Apply 3 The beeper beeps and the Busy LED blinks until the upgrade is complete e The beeper only beeps if it is enabled in the System Notification menu e Check Thecus website for the latest firmware release and release notes e Downgrading firmware is not permitted Do not turns off the system during the firmware upgrade process WARNING This will lead to a catastrophic result that may render the system inoperable UPS Setting The Thecus IP storage can also support various uninterruptible power supply unit via either Serial or USB interface depend on model to provide extra data security and accessibility in the case of a power failure From the Status menu choose the UPS item and the UPS Setting screen appears Make any changes you wish and press Apply to confirm changes 46 Menu Li d Sytem Information r UPS Setting Cok ary A ni SMe nt z z ae 1 mes x A em Management J UPS monitoring J E
158. xpanded even further using the stackable function With it users can expand the capacity of their network storage systems up to 5 other stack target volumes which are located in different systems These can be stacked through single network access like SMB or AFP acting as a share folder type Stackable Config to act as Stack Master Available target device from 1U4500 N5200 PRO Capacity Can connect total 5 Thecus target device Up to 20 TB capacity From the main menu the stackable feature is located under Storage Please refer the figure below for reference d Sytem nometni Stack Target List AM System Management Qu E ep ro zm E System Network Export share name P Canacity Uzed Talal Stats Dezerpbnn d E Storage LJ Disks LJ s B Pun Ailn owe T Spa PURIC i Pa 3 pma Stackable zi 150 Mount E User and Group Authenticabon A Add a Stack Target Volume From the figure above click Add to access the stackable target device configuration page Please refer to the figure below With the added stack target you could Enable or Disable now or later per usage needed 92 Add iSCSI Target Add Stack Target x Enable 13CSI Target Stackable Target IP 172 16 65 157 ign ign 2009 05 com thecus FS 15cs10 vel 1scsi Username Password Export share name Limit 0 9_ a z Description Browseable Gi ves i ne Aps anig Public C yes Oni Next input the tar
159. y WARNING There is no way to rescue data back if the key is lost With RAID volume encryption enabled the system performance will goes down With RAID volume encryption enabled RAID volume expansion will operated in off line mode RAID volumes with encryption enabled will be displayed with a key lock symbol next to volume ID name RAID Information Master RAID ia Disks Total Data iSCSI RAID Level Used Capacity Capacity Capacity o RAD amp 0 Healthy 12 219 8 GE 0265 2115 GB N A nata O iscsi E Unused Specify a stripe size 64K is the default setting Specify the percentage allocated for user data by drag the horizontal bar The remaining space will be made available for iSCSI Selected the file system you like to have for this RAID volume The selection is available from ext3 XFS and ZFS 66 Select ZFS file system while snapshot is needed It is only one ZFS file system allowed to be created per system ZFS file system is only accessible by CIFS SMB not for AFP and NFS users XFS file system is not support folder quota feature RAID Information Create RAID Disk Ha Capacity MB Model Status Used Spare 1 1 507 729 WDC WD2002 OK F i 2 1 907 720 WDC VD2002 OK oO 3 1 907 729 WDC V D2002 Warning oO a 4 1 907 729 WDC V D2002 OK O 5 1 907 729 WDC WD2002 OK r1 q 6 1 907 729 WDC V D2002 OK r1 r1 sl RAID Level JBOD fa RAID i E RAID 1 ERAD 5 CYRA

Download Pdf Manuals

image

Related Search

Related Contents

SILVER ICE CUBE MAKER - Princess  View - Industry Gear  HP BladeSystem c7000 Enclosure Setup and Installation Guide  Space Tracer 4000  Widex Menu Micro  Maintenance Pompe Hydraulique  Princeton Tec Push  Raptor HDx User Manual  SpaceSaver Bedienung und Montage  Manual Técnico - Acabadora de Superfície.cdr  

Copyright © All rights reserved.
Failed to retrieve file