Home

Multi-Tech Systems GPRS (MTMMC-G) Network Router User Manual

1. Unsolicited Result CCWA numbers type class alpha when waiting service is enabled Command Possible responses AT CCWA 1 1 1 OK Note Enable call waiting for voice Note Command valid calls AT CCWA 1 2 CCWA 1 1 Note Interrogate call waiting OK Note Call waiting active for voice calls CCWA 0146290800 145 1 FREDDY Note Number and name of the waiting voice call or CCWA 70146290800 145 1 8023459678FFFF UCS2 format AT CCWA 1 0 7 OK Note Erase call waiting Note Command valid CCWA 1 Note voice call waiting no number AT CCWA CCWA lt n gt OK AT CCWA CCWA List of supported lt n gt OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 82 Chapter 10 Supplementary Services Commands Calling Line Identification Restriction CLIR Description Values Syntax This command controls the Calling Line Identification restriction supplementary service lt n gt Sets the line ID restriction for outgoing calls 0 Presentation indicator is used according to the subscription of the CLIR service 1 CLIR invocation 2 CLIR suppression lt m gt Shows the subscriber CLIR status in the network CLIR not provisioned CLIR provisioned in permanent mode Unknown no network CLIR temporary mode presentation restricted CLIR temporary mode presentation allowed khOND Command synt
2. 86 Advice of Charge CAOC sessses 85 Gall Bairing GI IS iiie ciao rneer SUUS PA SERRE 81 Gall Forwarding 4HOG EG ciici sees addini ia a 80 Call Related Supplementary Services CHLD 87 Gall Waiting BGC WA npansin 82 Calling Line Identification Presentation CLIP 83 Calling Line Identification Restriction CLIR 83 Closed User Group CCUG iei iciatis 91 Connected Line Identification Presentation COLP 84 List Current Calls CL CC sss 88 Modify SS Password CPWD ccccseseeeeeeseeeeeees 81 Price Per Unit and Currency Table CPUC 86 Supplementary Service Notifications CSSN 89 Unstructured Supplementary Service Data CUSD 90 Commands V24 V25 Auto Tests GT iiie ERI HRS 104 Baek to Online Mode icon ch cete cte 102 DCE Response Format V icio tie tet repente 103 Default Configuration Z i eee teint 103 Display Configuration amp V sesseeeesese 105 DTE DCE Character Framing ICF 100 DTE DCE Local Flow Control IFC 101 Ec E ee r HII I 104 Fixed DTE Rate IPR sssssssseneees 99 Multiplexing Mode WMUX esee 106 Request Identification Information 105 Restore Factory Settings amp F eue 104 Result Code Suppression Q ss 102
3. 156 Phone activity status CPAS ssesssssssssss 17 Phone number Jenggirat 11 Phonebook Character Set WPCS sussss 14 Phonebook Phone Search CPBP ususss 5d PIN Remaining Attempt Number CPINC 42 Play DTMF Tone WDTMF seen 118 Play Tone SWTONE3 e iuine cordis teneis irdoe Denuo tardus 117 Poweroff GPOFP riis iHi itis iiie 16 Preferred Message Format CMGE ssss 64 Preferred Message Storage 4CPMS 63 Preferred Operator List CPOL ssessssss 37 Price Per Unit and Currency Table CPUC 86 Product Serial Number amp CGSN ssssessss 14 Q Q Result Code Suppression sess 102 Quality of Service Profile Minimum Acceptable CGQMIN tocca eu II UE I NU 154 Quality of Service Profile Requested CGQREQ 151 R Radio Link Protocol Parameters CRLP 96 Read a Phonebook Group WPQGW ssss 58 Read GPIO Value WIOR eene 114 Read Language Preference 4WLPR 113 Read Message 4 OM GR 1er tette ntes 68 Read Operator Name COPN sssssssseeeees 39 Read Operator Name WOPN sssseeeeee 34 Read Phonebook Entries CPBR ususssse 47 Redial Last Telephone Number
4. Syntax Command Syntax AT CSVM lt mode gt lt number gt lt type gt Command Possible responses AT CSVM CSVM 1 660 129 Note Get mail number OK Note Voice mail number 660 is activated AT CSVM CSVM 0 1 129 145 OK Note Possible values Note activation deactivation and format 129 amp 145 are supported AT CSVM 0 888 129 OK Note Disable Voice Mail number and change value to 888 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 56 Chapter 8 Phonebook Commands Contact Selector WCOS Description This commands enables disables the displaying of extended contact lt mode gt 0 Select the SIM contacts 1 Select the extended contacts for phonebook entries Values 2 Internal use only 3 Syntax Command Syntax AT WCOS lt mode gt Command Possible responses AT WCOS WCOS 1 Note Test command OK Note Extended contact selected AT WCOS WCOS 0 2 Note List all possible values OK AT WCOS 0 Note Contact not selected Note Displays all possible responses OK AT WCOS 3 CME ERROR 3 Note Mode not allowed Create and Delete a Phonebook Group WPGW Description This commands creates or deletes a phonebook group Values lt index gt Index a new group lt name gt Name of the group It can be up to 30 ASCII characters or 13 UCS2 characters long Syntax Command Syntax AT
5. 130 Preferred Operator List CPOL sss 37 Customer Storage Mirror WMIR 130 Read Operator Name COPN siseses 39 Data Hate WDR iii p iet 120 Read Operator Name WOPN eseesee 34 Downloading WDWL ccessececeeeseeeeesteeeeseees 118 Selection of Preferred PLMN List CPLS 36 General Indications WIND esses 109 Signal Quality GO ss c occeec eoe ite de opio pcd pad 31 Hang UP WAT soci ceni c eie nT 136 Commands Phonebook Input Output Management WIOM 115 Avoid Phonebook Initialization WAIP 56 Bor VVC FR TTL 125 Contact Selector WCOS sssses 57 Mobile Equipment Event Reporting CMER 112 Create and Delete a Phonebook Group WPGW 57 Multi Band Selection WMBS ssss 137 Delete Calls Phonebook WDCP sss 56 Network Operator Name WNON s 129 Find Phonebook Entries amp CPBF sss 52 Open AT Control Command WOPEN 133 Move Action in Phonebook CPBN sss 54 Play DTMF tone WDIMF uii eee tiene tegens ess 118 Phonebook Phone Search CPBP 53 Play Tone SWTONE tincid e by Re dires rase ido red 117 Read a Phonebook Group WPQGNW
6. 24 omdie N mbering Scheme E Eel dm 24 AAI RONAN ANGOR S A RT m 24 Microphone Mule Control OMIT rise rd kir E eE E E 26 Spesker amp Microphone Selection 4SPERKER ie ioi rn Een rra x tU FR E tI eminem REP PRX HEU bae EH EE ERI FEY CREE dE 26 Echo Gancelaionr conos 0 0 SnFR 27 Se Tone Modiieaton Fo IDE T eve e T UTI treet err 30 iniae vce Parameters AVP tet P HS 30 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 3 Table of Contents Chapter 6 Network Service Commands 0 cccsccceeeeeeeeeeeeeeeeeeeneeeeeeeeeeaseeeeeaneaeseeeneeesaaeaeeeseseaesesseeauaaeeneessseenanseeeenens 31 CISQCINEID AE Isc o C e Pru 31 COST EE Selecion IN ore I 31 uds curd e ilr lt M 33 Operaior Lise Weragement ISIN M em 33 Head Operator Namo 2 9 Meme 34 Salton oT Pretered PLMN EISE DPI S e ainsi ue envie bet dde Hbcek bod ad redd eire tec d Erebi dra da ER opc Git aecde eet cde 36 Peiered Operator Eist P s eec wwe 37 Read Operator Name sOOPN nn 39 Chapter 7 Security Commands osson esee enne nnne tn nn nnn nn iain tnis inia trsn sete na sante ness sinn anser ia nn nnne nnn 40 zal zl WE UD RE TI OL S UU LI EU S I yt 40 EXIST PIBES SEES d aeneo er rene A A meee ird HEIDI IER etre buo Tre ciat RM oU marron ULL Fabr RE Vin E D re nner nf 42 FIN Remialnine Attempt Number SOPIBIG a a
7. Command Possible responses AT CPBF Note Test command CPBF 20 10 OK Note Maximum length for a phone number is 20 digits 14 characters for the text AT CPBF E Note Read entries with E CPBF 12 112 129 Emergency CPBF 15 331290101 145 Eric OK Note Display locations with text field starting with E AT CPBF H Note Read entries with H CME ERROR 22 Note Entry not found AT CPBF 800001 Note Read entries starting with 0001 UCS2 character CPBF 11 0146290921 129 8000010002FFFF OK Note Display locations with text field starting with 0001 UCS2 character AT CPBF 8045C Note Read entries with 8045C ASCII format CME ERROR 22 Note Entry not found The string has a wrong UCS2 format it is therefore considered as an ASCII string AT CPBS SM OK Note ADN phonebook AT WCOS 0 OK Note Phonebook not extended AT CPBF Test Note Read entries with Test CPBF 1 0123456789 129 Test ADN Note Display locations with text field starting with Test AT WCOS 1 Note Phonebook extended OK AT CPBF Test Note Read entries with Test CPBF 1 0123456789 129 Test ADN 0 Note Display locations with text field starting with Test extended entry AT CPBS ME OK Note ADN phonebook AT WCOS 0 OK Note Phonebook not extended AT CPBF T
8. Response syntax OK or CME ERROR lt err gt Command Possible responses AT WTONE 1 1 300 9 50 OK Note Play a tone Note Done AT WTONE 0 OK Note Stop playing Note Done AT WTONE OK Note Test command Note Done AT WTONE ERROR Note Current value AT WTONE 1 1 300 9 50 600 9 OK Note Play a tone with 2 frequencies allowed with speaker only Note Done AT WTONE 1 2 300 9 50 600 9 CME ERROR 3 Note Dual Note Play a tone with 2 frequencies with the buzzer frequency for speaker only Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 117 Chapter 13 Specific AT Commands Play DTMF Tone WDTMF Description Values Syntax This command allows a DTMF tone to be played on the current speaker DTMF gain and duration can be set Note This command is only used to play a DTMF tone To send a DTMF over the GSM network use the VTS command mode 0 Stop playing 1 Play a DTMF tone lt dtmf gt Sets the DTMF to play in mandatory if lt mode gt 1 Value must be in 0 9 A B C D gain 0 15 Sets tone gain The values are identical to those of the WTONE speaker command Range is 0 to 15 see array on previous page By default the value is 9 duration 0 50 Sets the tone duration unit of 100 ms Range 0 to 50 Default 0 1 gt 0 1 s 50 gt 5 s When this parameter is 0 default value the duration is infinite
9. Command syntax AT WDR out coding type in coding type AT WDR out coding type in coding type AT WDR WDR out coding type in coding type Note out coding type is related to outgoing calls and in coding type to incoming calls Command Possible responses AT WDR WDR 0 2 0 2 Note If Half Rate is available in both directions AT WDR WDR 0 1 OK Note If Half Rate is notavailable AT WDR 1 OK Note Configure data type FR HR with HR Note Bearer is configured preferred for outgoing calls lt in_coding_type gt parameter is omitted AT WDR 1 OK Note Configure data type FRfor incoming Note Bearer is configured calls lt out_coding_type gt parameter is omitted AT WDR 3 CME ERROR 3 Note Illegal value Note Syntax error AT WVR WVR 1 1 Note Ask for the current values OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 120 Chapter 13 Specific AT Commands Select Voice Gain WSVG Description The product has 2 voice gain controllers This specific command selects the microphone gain controller Values lt n gt Controller 0 Controller 1 Default 1 Controller 2 Syntax Command syntax AT WSVG lt n gt Command Possible responses AT WSVG lt n gt AT WSVG 0 OK Note Select Controller 1 Default Note Controller 1 selected AT WSVG 1 OK Note Select Controller 2 Def
10. mode controls the processing of unsolicited result codes specified within this command Read command returns the current mode and buffer settings Test command returns the modes and buffer settings supported by the modem as compound values mode 0 Buffer unsolicited result codes in the modem if modem result code buffer is full the oldest ones can be discarded No codes are forwarded to the DTE 2 Buffer unsolicited result codes in the modem when modem DTE link is reserved e g in on line data mode and flush them to the DTE when modem DTE link becomes available otherwise forward them directly to the DTE 0 Modem buffer of unsolicited result codes defined within this command is cleared when mode 1 or 2 is entered This is the only case supported 1 Modem buffer of unsolicited result codes defined within this command is flushed to the DTE when mode 2 is entered This case is not supported The software provides a combination of all modes When a serial link is available indications are forwarded directly to the DTE If a serial link is reserved e g in on line data mode or the modem result code buffer is full the oldest ones can be discarded Command Syntax AT CGEREP Possible Responses AT CGEREP mode OK ERROR AT CGEREP CGEREP lt mode gt lt bfr gt OK AT CGEREP CGEREP list of supported lt modess list of supported lt bfr gt s OK Unsolicited Result Codes and Corresponding Even
11. 9876543210 129 email mail_address com post address 0 Note Display locations with text field starting with Test extended entry Move Action in Phonebook CPBN Description This specific command performs a forward or backward move in the phonebook in alphabetical order It is not allowed in the EN phonebook since it does not contain alphanumeric fields Values lt mode gt 0 First item 1 Last item 2 Next valid item in alphabetical order 3 Previous valid item in alphabetical order 4 Last item read usable only if a read operation has been performed on the current phonebook since the end of initialization 5 Last item written usable only if a write operation has been performed on the current phonebook since the end of initialization lt loc gt Location number lt num gt Phone number lt type gt TON NPI Type of address octet in integer format lt contact gt Contact structure Syntax Command Syntax AT CPBN lt mode gt Response Syntax e The entry is stored in the ADN phonebook and AT WCOS 0 lt CR gt lt LF gt CPBN lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the ADN phonebook with AT WCOS 1 lt CR gt lt LF gt CPBN lt loc gt lt num gt lt type gt lt name gt lt Phb_group gt e The entry is stored in the Mobile Equipment phonebook with AT WCOS 0 lt CR gt lt LF gt CPBN lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the
12. AT CPOL Note Ask for preferred list of networks With only EF_PLMNsel present CPOL 1 2 26201 CPOL 6 2 20810 OK Note Preferred list of networks in numeric format read in EF_PLMNsel AT CPOL Note Ask for preferred list of networks With EF PLMNwAct selected and present CPOL 1 2 26201 1 0 0 CPOL 6 2 20810 1 0 0 OK Note Preferred list of networks in numeric format read in EF PLMNwAct GSM acces technology selected GSM compact acces technology not selected Utran acces technology not selected Note Ask for preferred list of networks With only EF PLMNsel present AT CPOL 0 OK Note Select long alphanumeric format AT CPOL CPOL 1 0 D1 TELEKOM CPOL 6 0 F SFR OK Note Preferred list of networks in long alphanumeric format AT CPOL 7 2 20801 Note Add a network to the list OK AT CPOL Note Ask for preferred list of networks With only EF_PLMNsel present CPOL 1 0 D1 TELEKOM CPOL 6 0 F SFR CPOL 7 0 Orange F OK Note Preferred list of networks in long alphanumeric format Note Ask for preferred list of networks With only EF_PLMNsel present AT CPOL 7 OK Note Delete 7 location AT CPOL CPOL 1 0 D1 TELEKOM CPOL 6 0 F SFR OK Note Preferred list of networks in long alphanumeric format AT CPOL 8 2 77777 Note Add a new network to the list With only EF_PLMNsel present OK AT CPOL 8 2 77777 0 0 1 Note Add a new netwo
13. Contact structure Values lt index gt lt number gt lt type gt lt text gt lt contact gt lt Phb_Group gt Integer type value depending on the capacity of the phonebook memory Phone number in ASCII format TON NPI Type of address octet in integer format Note The value is 145 if the dialing string lt number gt response value includes the international access code character otherwise the value is 129 Example a lt type gt value of 17 will be written as 145 String type Maximum length of lt text gt field is e For the Mobile Equipment phonebook 30 ASCII characters e For the ADN phonebook SIM dependent use AT CPBW Notes e For the lt text gt parameter all strings starting with 80 81 or 81 are considered in UCS2 format e The CSCS Select Character Set command does not affect the format for phonebook entries Contact structure Phonebook group number in which the entry should be saved The range is 1 to 10 If the entry must not be saved in a group lt Phb_Group gt 0 or can be omitted Syntax Command Syntax e For ADN phonebook with AT WCOS 0 AT CPBWs lt index gt lt number gt lt type gt lt text gt e For ADN phonebook with AT WCOS 1 AT CPBWs lt index gt lt number gt lt type gt lt text gt Phb_group gt e For the Mobile Equipment phonebook with AT WCOS 0 AT CPBWs lt index gt lt number gt lt type gt lt text gt e For the Mobil
14. Message received Note Unread message received from 0146290800 on the 01 10 1998 at 18H19m 20s AT CMGD 3 OK Note Delete it Note Message deleted AT CMGD 1 0 OK Note The message from the preferred message storage at the location 1 is deleted AT CMGD 1 1_ OK Note All READ messages from the preferred message storage are deleted AT CMGD 1 2 OK Note All READ messages and SENT mobile originated messages are deleted AT CMGD 1 3 OK Note All READ SENT and UNSENT messages are deleted AT CMGD 1 4 OK Note All messages are deleted Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 73 Chapter 9 Short Messages Commands Service Center Address CSCA Description This command indicates the service center to which the message must be sent The product has no default value for this address If the application tries to send a message without having indicated the service center address an error will be generated Therefore the application must indicate the SC address when initializing the SMS This address is then permanently valid The application may change it if necessary Values lt sca gt service center address Syntax Command Syntax AT CSCA lt sca gt Command Possible responses AT CMGS 33146290800 lt CR gt CMS ERROR 330 Hello how are you lt ctrl Z gt Note service center unknown Note Send a message AT CSCA 0696741
15. Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 107 Chapter 13 Specific AT Commands e Combination of the requested dump is supported addition of the values 1 2 4 and 8 Value Requested Dump Value Requested Dump 1 CCED response Main Cell only 9 CSQ response then CCED response with Main Cell only 2 CCED response Neighbors 1 to 6 10 CSQ response then CCED response with Neighbors 1 to 6 3 CCED response Main Cell then Neighbors 1 11 CSQ response then CCED response with to 6 Main Cell then Neighbors 1 to 6 4 CCED response Timing Advance Only 12 CSQ response then CCED response with Timing Advance Only 5 CCED response Main Cell then Timing 13 CSQ response then CCED response with Advance Main Cell then Timing Advance 6 CCED response Neighbors 1 to 6 then 14 CSQ response then CCED response with Timing Advance Neighbors 1 to 6 then Timing Advance 7 CCED response Main Cell then Neighbors 1 15 CSQ response then CCED response Main to 2 then Timing Advance Cell then Neighbors 1 to 6 then Timing Advance 8 CSQ response Main Cell RSSI indications 16 CCED response Main Cell then Neighbors 1 to 6 then Main Cell Timing Advance then Neighbor1 to Neighbor6 Timing Advance No Last value used for CCED request or 15 value e f requested dump parameter is not provided one of the last CCED commands sill be used or
16. Note no answer AT amp W Note Save modifications in EEPROM Caution The given value should be stored in EEPROM Therefore the AT amp W command must be used to save the new lt mode gt value Note No phonebook commands are allowed if WAIP 1 after boot If a phonebook command is entered a CME ERROR 3 is returned Delete Calls Phonebook WDCP Description This specific command deletes the calls listed in some phonebooks Values calls phonebook gt LD SIM ME extended Last dialing phonebook MC ME missed calls list phonebook RC ME received calls list phonebook Syntax Command Syntax WDCP lt calls phonebook gt Command Possible responses AT WDCP OK AT WDCP WDCP LD MC RC OK Note Possible values Note Identifiers of the phonebooks supporting a list of calls AT WDCP LD OK Note Delete all the content of Last Dialing phonebook Note Last Dialing phonebook is now empty Set Voice Mail Number CSVM Description This commands sets gets and enables disables the voice mail number in memory Values lt mode gt 0 Disable the voice mail number 1 Enable the voice mail number number Phone number in ASCII format type TON NPI Type of address byte in integer format Note The value is 145 if the dialing string includes the international access code character Otherwise the value is 129 Example A type value of 17 will be written as 145
17. PLAY TONE 0 0 0 0 0 y REFRESH___ ee ee t REFRESH RUN AT COMMAND ATS him rc SELECT ITEM X SEEECTITEM C t O SEND SHORT MESSAGE X xXx SEND SS X SENDSS _ S O SEND USSD ooo EENEN S X X SET UP EVENT LIST EX SET UP IDLE MODE TEXT IdleModeText EE O X X SMS PP DOWNLOAD CE X X X TIMER MANAGEMENT Timer EE num TIMEREXPIRATION S Timn Lc TABLE 2 Compatibility between Available Terminal Responses and Proactive Commands i E Proactive commands Terminal Reponses Setup Display Get Get Setup Play Select Refresh Send Send Send Setup Menu Text 4 nkey Input Call Tone Item 7 SS SMS USSD event 0 2 3 5 6 8 9 10 list 11 Backward Move 95 e e e e Command beyond ME capabilities 96 T ME currently unable to 7 2 H process command 97 No response from the user 98 A SIM session terminated by the A user 99 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 187 Appendix C Structure of the Terminal Profile Appendix C Structure of the Terminal Profile First byte Download b8 b7 b6 bd b4 Profile download SMS PP data download Cell Broadcast data download Menu se
18. SIM Toolkit Unsolicited Result SIM Toolkit Control Response STCR Description Values Syntax When the customer application makes an outgoing call or an outgoing SMS and if the call control facility is activated CALL CONTROL and SMS CONTROL responses can be identified This is also applicable to SS calls lt Result gt 0 Control response not allowed 1 Control response with modification Number Called number Service Center Address or SS String in ASCII format lt MODestAddr gt MO destination address in ASCII format Textlnfo Text information in ASCII format Command Syntax STCR lt Result gt lt Number gt lt MODestAddr gt lt TextInfo gt SIM Toolkit Give Response STGR Description Values Syntax Values This command allows the application user to select an item in the main menu or to answer the following proactive commands e GET INKEY Key Pressed By The User e GET INPUT Message Entered By The User e SELECT ITEM Selected Item e SETUP CALL User Confirmation e DISPLAY TEXT User Confirmation To Clear The Message e SETUP EVENT LIST Reporting events It is also possible to terminate the current proactive command session by sending a Terminal Response to the SIM with the following parameters e BACKWARD MOVE Process a backward move e BEYOND CAPABILITIES Command beyond ME capabilities e UNABLE TO PROCESS ME is currently unable to process command e NO RESPONSE No respon
19. lt dcs gt Note Please be aware that the send USSD command needs the user to re enter the n parameter Values for Send and Receive USSD str The USSD string to be sent dcs The default alphabet and the UCS2 alphabet are supported When the product sends a USSD an OK response is first returned the intermediate CUSD indication comes subsequently In case of error a CUSD 4 indication is returned Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 90 Chapter 10 Supplementary Services Commands Closed User Group CCUG Description Values Syntax The Closed User Group Supplementary Service enables subscribers to form closed user groups with restricted access both access to and from The CUG supplementary service is described in GSM 02 85 This service is provided on prior arrangement with the service provider Subscription options should be selected at implementation The CCUG command is used to e Activate deactivate the control of CUG information for all following outgoing calls e Select a CUG index e Suppress outgoing access OA OA allows a member of a CUG to place calls outside the CUG e Suppress the preferential CUG Preferential is the default CUG used by the network when it does not receive an explicit CUG index lt n gt 0 Disable CUG mode default 1 Enable CUG mode lt index gt 0 9 CUG index 0 default 10 Preferred CUG lt info gt 0 No information def
20. 0 61 0 61 40 255 1 255 0 Note Test command OK Note V42bis not supported AT CRLP CRLP 0 61 0 61 40 255 1 255 0 1 Note Test command OK Note V42bis supported AT CRLP 61 61 48 6 0 OK Note Set new parameters Note Command valid AT CRLP AT CRLP 61 61 48 6 0 Note Current values Note Command valid Other Radio Link Parameters DOPT Description This command modifies some supplementary radio link protocol parameters Values lt reset_allowed gt 0 Data communication is hung up in case of bad radio link 1 Default Data communication continues in case of bad radio link possible loss of data lt dtx_allowed gt 0 Normal mode 1 Default Economic battery mode not supported by all networks Syntax Command syntax AT DOPT lt reset_allowed gt lt dtx_allowed gt Command Possible responses AT DOPT 1 OK Note Set new parameters ga value is the default Note Command valid AT DOPT 0 1 0 1 Note Test command OK Note DTX is supported AT DOPT 1 1 OK Note Set new parameters Note Command valid AT DOPT 1 1 Note Current values OK Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 96 Chapter 11 Data Commands Select Data Compression 5C This command enables or disables data compression negotiation if this feature is supported on the Description Values Syntax product lt
21. 16 requested dump gt 1 requested dump gt 2 requested dump gt 4 Neighbor1 to Neighbor6 Timing Advance only available for mode 0 Neighbor1 to Neighbor6 Timing Advance are only available in Idle Mode lt CsqStep gt Indicates the step required for RSSI indications between 2 CSQ unsolicited response The range of this step is 1 5 Default value 1 If this field is not indicated the previous value is used Notes e The response for the requested dump 1 2 and 4 will be CCED lt value gt value n gt OK Where lt value gt is the ASCII string of the values in decimal form except the LAC and Cl values which are in hexadecimal form of the parameters If a field cannot be measured or is meaningless the parameter is not filled in and two consecutive commas are sent e The response for the requested dump 8 will be a CSQ response and not a CCED The 7 07 format for CSQ is respected The ber is not evaluated by this command so the ber value will always be 99 CSQ lt rssi gt 99 OK When automatic shots are selected this CSQ response is sent every time the lt rssi gt measured by the product is equal or greater than the value lt CsqStep gt So the lt rssi gt level between 2 successive CSQ responses is equal or greater than lt CsqStep gt Automatic shots are supported in idle mode and during communication The activation or deactivation of this flow 8 does not affect the other flows
22. 58 Read GPIO Value WIOR esee 114 Read Phonebook Entries amp CPBR ss 47 Read Language Preference WLPR 113 Select Phonebook Memory Storage CPBS 46 Reset A WAGI eee m 135 Set Voice Mail Number CSVM seesess 56 Ring Indicator Mode WRIM seen 122 Settings of a Phonebook Group WPGS 59 Scan 4MIBORAN iu nthe iets eatin 122 Subscriber Number CNUM eeeeeees 55 Select Voice Gain WSVG sess 121 Write Phonebook Entry CPBW seseses 49 Set Standard Tone WSST eussssss 185 Commands Security Status Reguest AWST Rorirori 121 Change Password CPWD cccsscceeeeseeeeesneeees 44 Unsolicited Result Diverted Call Indicator WDCI 128 Enter PIN OPI secccasccteccacoesttveacieesntebieiarnteateteces 40 Unsolicited Result Voice Mail Indicator WVMI 128 Enter PIN GPIN2 iii ette te Rete dese 42 Voice Rate WV M 119 Facility Lock GEO inii eio it cett ect 43 Write GPIO Value WIOW eeeenn 114 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S000293l 200 Write Language Preference WLPNW 113 Commands Supplementary Services Accumulated Call Meter CAOM 85 Accumulated Call Meter Maximum CAMM
23. CME ERROR 3 precision AT CPHS CPHS lt Fctld1 gt lt Status gt lt CR lt LF gt CPHS lt Fctld2 gt lt Status gt lt CR lt LF gt CPHS lt Fctldn gt lt Status gt lt CR lt LF gt OK AT CPHS OK Interrogate the status of CPHS functionality CPHS 1 0 Voice mail indicator functionality is deactivated CPHS 2 0 Mail box number functionality is deactivated CPHS 3 1 Alternate Line Serve functionality is activated CPHS 4 0 Divert Call Indicator functionality is deactivated CPHS 5 1 Network Operator functionality is activated CPHS 6 1 CPHS Information functionality is activated CPHS 7 1 Customer Service Profile functionality is activated OK Syntax error CME ERROR 3 Activate the voice mail indicator functionality OK Examples continued on next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 126 Chapter 13 Specific AT Commands AT CPHS the message box contains 1 message The message box contains a second message AT CPHS 1 4 RKREK AT CPHS 2 1 AT CPHS 1 2 AT WALS 1 AT CPHS 0 4 AT CPHS AT CPHS 2 2 Interrogate the status of CPHS functionality CPHS 1 1 Voice mail indicator functionality is activated CPHS 2 0 Mail box number functionality is deactivated CPHS 3 1 Alternate Line Serve functionality is activated CPHS 4 0 Divert Call Indicator functionality is deactivated CPHS 5 1 Network Opera
24. CPIN SIM PIN The product requires SIM PIN AT CPIN 1235 First attempt to enter a SIM PIN CME ERROR 16 Wrong PIN AT CPIN 1236 Second attempt CME ERROR 16 Wrong PIN AT CPIN 1237 Third attempt CME ERROR 16 Wrong PIN AT CPIN Read PIN state CPIN SIM PUK The product requires PUK AT CPIN 99999999 5678 The PUK is entered the new PIN shall be 5678 PUK validation is OK New Pin OK is 5678 AT CPIN Read PIN state CPIN READY The product is ready If the user tries to do something which requires PIN2 CHV2 the product will refuse the action with a CME ERROR 17 SIM PIN2 required The product then waits for SIM PIN2 to be given Of course if SIM PIN2 is blocked SIM PUK2 is required instead of SIM PIN2 For example the product needs PIN2 to write in the fixed dialing phonebook FDN so if SIM PIN2 authentication has not been performed during the current session SIM PIN2 is required Command Possible responses AT CPBS FD OK Note Choose FDN AT4CPBWz5 01290917 129 Jacky CME ERROR 17 Note Write in FDN at location 5 Note SIM PIN is required AT CPIN SIM PIN2 Note SIM PIN2 is required AT CPIN 5678 OK Note Enter SIM PIN2 AT4CPBWZ2 01290917 129 Jacky OK Note Write in FDN at location 5 Note Now writing in FDN is allowed Please note that the product only requests PIN2 or PUK2 once Therefore if they are not entered properly the next CPIN command will return
25. CPMS 1 99 1 99 1 99 OK AT CMGR 1 Note Read the first SMS from the CMGR REC READ 0146290800 98 10 01 18 22 11 00 lt CR gt lt LF gt My test message SMS in the SIM at location 1 the Flash at location 2 lt ctrl Z gt Note Write a message in text mode Flash OK AT4 CMGW 33146290800 CR CMGW 2 Other test message SMS in OK Note Message stored in index 2in the Flash AT CPMS Note Read the SMS storage CPMS ME 2 99 ME 2 99 ME 2 99 OK Note Read write SMS from to the Flash 2 SMS are stored in the Flash AT WMCP 1 2 Note Copy the SMS at location 2 in the Flash to the SIM OK AT CPMS SM ME SM Note Select SM for reading ME for writing and SM for storing CPMS 4 10 2 99 4 10 OK AT CMGR 4 Note Read the first SMS from the SIM CMGR REC UNREAD 33146290800 98 10 01 8 22 11 00 lt CR gt lt LF gt Other test message SMS in the Flash at location 2 OK Continued on the next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 78 Chapter 9 Short Messages Commands Command Syntx AT WMCP mode loc Continued Command Possible responses AT CPMS ME CPMS 2 99 2 99 4 10 Note Select ME for reading OK AT CMGD 0 4 OK Note Erase all the SMS stored in the Flash AT CPMS CPMS ME 0 99 ME 0 99 5M 4 10 OK Note
26. Command Syntax AT WMSC loc status Command Possible responses AT CMGR 2 CMGR REC READ 336290918 99 05 01 14 19 444 04 lt CR gt lt LF gt Hello All of you OK AT WMSC 2 REC UNREAD AT CMGR 2 CMGR REC UNREAD 336290918 99 05 01 14 19 44 04 lt CR gt lt LF gt Hello All of you OK Possible responses OK If the location is valid CMS ERROR 321 If lt loc gt is invalid or free CMS ERROR 302 If the new lt status gt and the previous one are incompatible 1 If all parameters are correct the product overwrites the whole SMS in SIM Only the first byte Status byte is changed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 75 Chapter 9 Short Messages Commands Message Overwriting WMGO The CMGW command specifies a location in the SMS or Flash memory for the next SMS to be stored Description Important Notes Values Syntax when the CMGW indicates a message is ready to be stored The defined location is used only once WMGO has to used again to perform another overwrite e If the external application specifies a free location and an incoming message is received before the AT CMGW command occurs the product may store the incoming message at the specified available location If the user then issues an AT CMGW command without changing the location with another AT WMGO the received message will
27. Description This command returns phonebook entries with alphanumeric fields starting with a given string The AT CPBF command can be used to display all phonebook entries sorted in alphabetical order This command is not allowed for LD RC MC phonebooks and for the EN phonebook which does not contain alphanumeric fields It is possible to use this command with UCS2 strings If a wrong UCS2 format is entered the string is considered as an ASCII string Values lt string gt lt loc gt Searched pattern string depends on the format of the data stored in the phonebooks Location number 20 digits maximum lt num gt Phone number 20 digits maximum lt type gt TON NPI Type of address byte in integer format contact Extended contact structure Syntax Command Syntax AT CPBF lt string gt Response Syntax e The entry is stored in the ADN phonebook and AT WCOS 0 lt CR gt lt LF gt CPBF lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the ADN phonebook with AT WCOS 1 lt CR gt lt LF gt CPBF lt loc gt lt num gt lt type gt lt name gt lt Phb_group gt e The entry is stored in the Mobile Equipment phonebook with AT WCOS 0 lt CR gt lt LF gt CPBF lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the Mobile Equipment phonebook with AT WCOS 1 lt CR gt lt LF gt CPBF lt loc gt lt num gt lt type gt lt name gt lt Contact gt lt Phb_group gt
28. PUK validation forces the user to enter a new PIN code as a second parameter and this will be the new PIN code if PUK validation succeeds CHV1 is then enabled if PUK1 is correct The application therefore uses this command AT CPIN lt Puk gt lt NewPin gt Command Possible responses AT CPIN 00000000 1234 CME ERROR 16 Note Enter PUK and new PIN Note Incorrect PUK AT CPIN 12345678 1234 OK Note Enter PUK and new PIN 2nd attempt Note PUK correct new PIN stored To determine which code must be entered or not the following query command can be used AT CPIN The possible responses are CPIN READY ME is not pending for any password CPIN SIM PIN CHV1 is required CPIN SIM PUK PUK 1 is required CPIN SIM PIN2 CHV2 is required CPIN SIM PUK2 PUK is required CPIN PH SIM PIN SIM lock phone to SIM is required CPIN PH NET PIN Network personnalisation is required CME ERROR err SIM failure 13 absent 10 etc Please note that in this case the mobile equipment does not end its response with the OK string The response CME ERROR 13 SIM failure is returned after 10 unsuccessful PUK attempts The SIM card is then out of order and must be replaced by a new one Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 40 Chapter 7 Security Commands Example Three failed PIN validations one successful PUK validation AT CPIN Read the PIN status
29. apply whereas for an incoming call only the lt ce gt parameter applies Notes e For incoming calls if ce is set to T only and the network offers NT only or vice versa Then the call is released e The values 2 and 3 for the ce parameter are equivalent to the former values of 100 and 101 Those values are managed for compatibility purposes but they should no longer be used in the new code 2 as former 100 and 3 as former 101 Values speed 0 default Autobauding modem type none 1 300 bps modem type V 21 2 1200 bps modem type V 22 3 1200 75 bps modem type V 23 4 2400 bps modem type V 22bis 5 2400 bps modem type V 26ter 6 4800 bps modem type V 32 7 9600 bps modem type V 32 8 Specific 12 9600 bps modem type V 34 14 1400 bps modem type V 34 65 300 bps modem type V 110 66 1200 bps modem type V 110 68 2400 bps modem type V 110 70 4800 bps modem type V 110 71 9600 bps modem type V 110 75 14400 bps modem type V 110 This speed configures data and fax 14 4 kbps bearers name No data compression is provided and only asynchronous modem is supported lt name gt 0 lt ce gt Connection element 0 Transparent only 1 default Non transparent only 2 Transparent preferred 3 Non transparent preferred Syntax Command syntax AT CBST speed lt name gt ce Command Possible responses Note Test command AT CBST CBST 0
30. eseseessse 9 Mobile Station S 9 Mobile Terminated Call MTC eeeeeeeeese 9 MOC Mobile Originated Call esses 9 Modify SS Password CPWD noii ctu 81 More Messages to Send CMMS ssssss 79 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 201 Move Action in Phonebook CPBN uuesssse 54 MS Mobile Statio uiris tias te riso 9 MTC Mobile Terminated Call ssesssssss 9 Multi Band Selection WMBS sssussss 137 Multiplexing Mode WMUX eem 106 N N Select Data Error Correcting Mode 98 Network Operator Name WNON sseeses 129 Network Registration CREQG esses 33 Network Requested PDP Context Activation 163 New Message Acknowledgement CNMA 61 New Message Indication CNMI uussssse 66 O O Back to Online Mode ccccccccessseeeeeteeeessneeeeeees 102 Open AT Control Command WOPEN 133 Operator List Management WOLM 33 Operator Selection COPS sesersce tenetis 31 Other Radio Link Parameters DOPT 96 P Parameters Storage Mode sssssesssss 180 PDP Context Activate or Deactivate CGACT
31. ind 0 Noindicator event reporting 1 Indicator event reporting using unsolicited result code Only the indicator events not caused by CIND shall be indicated by the TA to the TE 2 Indicator event reporting using unsolicited result code All indicator events shall be directed from TA to TE DTE key Keyboard map is 5 5 press 1 key press 0 key release lt indresp gt Indicator order number as specified for CIND lt value gt New value of the indicator Command Syntax AT CMER lt mode gt lt keyp gt lt disp gt lt ind gt lt bfr gt Response Syntax CKEV lt key gt lt press gt key press event report Response Syntax CIEV lt indresp gt value indicator event report Command Possible responses AT CMER 1 OK Note Ask for key press event report CKEV 12 1 CKEV 12 0 Note Key 12 has been pressed and released AT CMER CMER 3 1 0 0 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 112 Chapter 13 Specific AT Commands Read Language Preference WLPR Description Read a Language Preference value of EF LP The first indices should have the highest priority Values index Offset in the available languages range SIM dependent value Values for language See Recommendation 3GPP TS 23 038 Language example value Language 0 German 1 E
32. lt CR gt lt LF gt data Class 3 CBMs as lt bm gt 2 Other classes CBMs as lt bm gt 1 Used for SMS STATUS REPORTS Default is 0 No SMS STATUS REPORTS are routed SMS STATUS REPORTs are routed using unsolicited code If PDU mode CDS length CR lt LF gt lt pdu gt If text mode CDS lt fo gt lt mr gt lt ra gt tora lt scts gt lt dt gt lt st gt SMS STATUS REPORTs are stored and routed using the unsolicited result code CDSI SR index lt bfr gt Default is 0 0 TA buffer of unsolicited result codes defined within this command is flushed to the TE when mode 1 3 is entered OK response shall be given before flushing the codes TA buffer of unsolicited result codes defined within this command is cleared when mode 1 3 is entered Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 66 Chapter 9 Short Messages Commands Syntax Command Syntax AT CNMl lt mode gt lt mt gt lt bm gt lt ds gt lt bfr gt Command Possible responses AT CNMI 2 1 0 0 0 OK Note lt mt gt 1 AT CMTI SM 1 Note message received AT CNMI 2 2 0 0 0 Note lt mt gt 2 OK CMT 123456 98 10 01 12 30 00 00 129 4 32 240 15379 129 5 lt CR gt lt LF gt Note message received Note Send a message in text mode AT CNMI 2 0 0 1 0 OK Note lt ds gt 1 AT CMGS 33146290800 lt CR gt CMGS 7 Happy Birthd
33. www multitech com Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 2 Table of Contents Contents Chapter diocesi e Q 9 SCOPE Ot THIS BOGEN re 9 Related DO CII IG M M 9 Bip me M 9 Chapter 2 AT Command Features eeeeeeeeeeeseeeeee enne nn enn nnne tn nnne nth sain tnis iss a aa aane tnn sane tenent 10 ES ID ERU T TU CT S TEENS 10 Commis DS ene cas piss a RI cea ene AVI ERE Eder nse bndam repe a cans aig Hs 10 lttonmation Responses and Result Codes ias re eotrip rir ber Spi Ea EE ER e nrc a Kerr ERE peg rera ai naan a EQUAU E cB iniiis 10 Chapter 3 Gonera Beha Vio CT M M 11 SIM Card Insenion and Removal ProcdutgS PT 11 zin get M rive Pee m 11 About the Langit of Phone Nurmbels cuocere rera tor orto PF xY PEE CEYEPPRANN ETE FE n FUE XYYEY FECE YR e ETkY YES FEX FURY Y RIS EET PE REA REN REIS 11 Chapter 4 General AT Commands iu oen rrt bta taa REEF III Med aiai RSEY RARE AREA AREE MAE DEAE R EXE Dx ge 13 Ilandtactaer IGEN ATION OEM sii occasio EEN ROREEHE MERE XRYEHIET REPERI RET M REM REDE 13 R gusst Model IHemiteatoR HOD UE sss nisi E CEEMER ER Ra ERREERRAR AE RAF a risa d AE DELE KA ex BAL REED RAE CY
34. 140 4VGR 4VGT Gain GOnITOL nisse tte Seria sa 24 VIP Initialize Voice Parameters ssss 30 VTD VTS DTMF signals esee 21 W32K 32kHz Power Down Mode 123 WAC Abort Command mI 116 WAIP Avoid Phonebook Initialization 56 WALS Alternate Line Service 132 SEV Hang sessi oca icto apro tosses anise tbe tenete 136 WCBM Cell Broadcast Message ldentifiers 75 WCCS Custom Character Set sss 124 WCDM Change Default Melody 123 WCDP Change Default Player ssss 130 SWOOS Contact SelectOra uit rt tern 57 WGPI GPHS IDfOI m eitOL euis ri cra Ete rnt 129 WCSP Customer Service Profile 130 WDCI Unsolicited Result Diverted Call Indicator 128 WDCP Delete Calls Phonebook 56 WDR Data Pale nicsisesticisdestptivi ice e rr TE PREBIA ed ERE EIE 120 WDTMF Play DTMF TODE ascascttixec cu to oT Hoe snags 118 zWDWE Downloading scii coats tears recti mite iacet 118 WGPRS GPRS Parameters Customization 168 WIND General Indications ee 109 WIOM Input Output Management 115 WIOR Read GPIO ValU xiciccccsiictntecentevcctiesncncen 114 WIOW
35. AT CMPS 17 23 64 244 OK Note lt vp gt 23 2 hours relative format Note Command correct lt dcs gt GSM 8 bits alphabet Reminder Enter lt fo gt value in decimal format Delete Message CMGD Description Values Notes Syntax This command deletes one or several messages from preferred message storage BM SMS CB RAM storage SM SMSPP storage SIM storage or SR SMS Status Report storage Refer to the Preferred Message Storage CPMS command lt index gt If lt DelFlag gt 0 1 20 Ifthe preferred message storage is BM e Sim dependent integer values in the range of SIM location number if the preferred message storage is SM or SR If lt DelFlag gt is gt 0 index is ignored lt DelFlag gt 0 Delete message at location lt index gt 1 Delete All READ messages 2 Delete All READ and SENT messages 3 Delete All READ SENT and UNSENT messages 4 Delete All messages If lt DelFlag gt is omitted default value is used When the preferred message storage is SR as SMS status reports are assumed to have a READ status if lt DelFlag gt is greater than 0 all SMS status reports will be deleted Command Syntax AT CMGD lt Index gt lt DelFalg gt Command Possible responses CMTI SM 3 Note New message received AT CMGR 3 CMGR REC UNREAD 0146290800 Note Read it 98 10 01 18 19 20 00 lt CR gt lt LF gt
36. AT CPHS 2 7 11 WCSP 11 1 Note Get current status of Barring All Outgoing OK International Calls Note Barring or All International Outgoing Calls is customer accessible AT CPHS 2 7 2 CME ERROR 3 Note Get current status of Call Forwarding on User Busy Note CPHS feature is not allowed AT CPHS 0 7 OK Note Deactivatation of CPHS Information Note No effect Customer Storage Mirror WMIR Description Values Syntax This command allow you to make a mirror copy of the current configuration parameters in the EEPROM In the case of a memory problem for the storage if a customer mirror already exists this one will be restored Otherwise the default mirrored parameters are restored Warning This command should be used only on special advice from a Technical Support person No parameters Command syntax AT WMIR Command Possible responses AT WMIR OK AT WMIR OK Note Build the Customer Mirror Change Default Player WCDP Description Values Syntax This command allows the default melody player to be selected lt player gt 0 Buzzer 1 Speaker Command syntax AT WCDP lt player gt Command Possible responses AT WCDP WCDP 0 1 OK AT WCDP 0 OK Note Select the buzzer AT WCDP WCDP 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 130 Chapter 13 Specific AT Commands CPHS Mail Box Number WMBN Descr
37. CPIN READY Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 41 Chapter 7 Security Commands Enter PIN2 CPIN2 Description This command validates the PIN2 code CHV2 or the PUK2 code UNBLOCK CHV2 and defines a new PIN2 code Of course the CPIN command allows PIN2 or PUK2 codes to be validated but only when the last command executed resulted in PIN2 authentication failure PIN2 length is between 4 and 8 digits PUK2 length is 8 digits only Values lt pin2 gt is the personal identification number 2 lt puk2 gt is the personal unblocking key 2 needed to change the PIN 2 lt newpin2 gt Note PIN2 length is between 4 and 8 digits PUK2 length is 8 digits only Syntax AT CPIN2 lt pin2 gt Command Possible responses AT CPIN2 1234 OK Note Enter PIN2 Note PIN2 code is correct AT CPIN2 5678 CME ERROR 3 Note Enter PIN2 Note Operation not allowed PIN2 previously entered After 3 unsuccessful attempts PUK2 will be required PUK2 validation forces the user to enter a new PIN2 code as a second parameter and this will be the new PIN2 code if PUK1 validation succeeds The application uses this command AT CPIN2 lt puk2 gt lt NewPin2 gt Command Possible responses AT CPIN2 00000000 1234 CME ERROR 16 Note Enter PUK2 and new PIN2 Note Incorrect Password PUK2 AT CPIN2 12345678 1234 OK Note Enter PUK2 and new PIN2 2
38. Command Possible responses AT VTD 6 OK Note To define 600 ms tone duration Note Command valid AT VTD 0 OK Note To set the default value 70 ms 5 ms AT VTD AT VTD lt n gt Note Query current tone duration OK AT VTD AT VTD lt 0 255 gt OK The product enables the user application to send DTMF tones over the GSM network This command enables tones to be transmitted only when there is an active call lt Tone gt DTMF tone to transmit Tone is in 0 9 A B C D Command Syntax AT VTS lt Tone gt Command Possible responses AT VTS A OK Note Command valid AT VTS 11 CME ERROR 3 Note To set the default value Note If the lt Tone gt is wrong AT VTS 4 CME ERROR 3 Note If there is no communication AT VTS 1 VTS 3 VTS OK Note Sed tone sequence 13 Redial Last Telephone Number DL Description Values Syntax This command redials the last number used in the ATD command The last number dialed is displayed followed by for voice calls only No parameters ATDL Command Possible responses ATDL 0146290800 Note Redial last number OK Note Last call was a voice call Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 22 Chapter 5 Call Control Commands Automatic Dialing with DTR D Description This command enables and disables e Automatic dialing of the phone
39. Command Syntax AT CGREG Possible response s AT CGREG lt n gt CGREG stat gt lt lac gt lt ci gt OK AT CGREG CGREG lt n gt lt stat gt lt lac gt lt ci gt OK Note CME ERROR lt err gt AT CGREG CGREG list of supported n s OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 161 Chapter 15 GPRS Commands Request GPRS IP Service D Description Values Syntax Example This command causes the modem to perform whatever actions are necessary to establish communication between the DTE and the external PDN The V 25ter D Dial command causes the modem to enter the V 25ter online data state and with the DTE to start the specified layer 2 protocol The modem returns CONNECT to confirm acceptance of the command prior to entering the V 25ter online data state No further commands may follow on the AT command line The detailed behavior after the online data state has been entered is described briefly in clause 9 for IP of GSM 07 60 GPRS attachment and PDP context activation procedures may take place prior to or during the PDP startup if they have not already been performed using the CGATT and CGACT commands If lt cid gt is supported its usage is the same as in the CGDATA command The CGDCONT CGQREQ etc commands may then be used in the modem initialization AT command string to set values for for PDP type APN QoS etc If lt
40. DTR switches ON OK Note Number in the ADN s first location is dialed automatically DTR switches OFF Note The product goes on hook AT D2 OK Note Activates DTR short message sending Note Command has been executed DTR is OFF DTR switches ON CMSS x Note The first short message is being sent AT D1 OK DTR is OFF DTR switches ON CME ERROR 21 Note No phone number in the ADN phonebook s first location or FDN phonebook if it s activated using the CLCK command AT D2 OK DTR is OFF DTR switches ON CME ERROR 321 Note No short message in the first location of the SIM Automatic Answer SO Description This SO parameter determines and controls the product automatic answering mode Values lt value gt The number of rings before an automatic answer 3 characters padded with zeros Range of values is 0 to 255 Syntax Command Syntax ATSO lt value gt Command Possible responses ATS0 2 OK Note Automatic answer after 2 rings ATSO 002 OK Note Current value Note always 3 characters padded with zeros ATS0 0 OK Note No automatic answer Note Command valid All others S parameters S6 S7 S8 are not implemented Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 23 Chapter 5 Call Control Commands Incoming Call Bearer CICB Description This command sets the type of incoming calls when no i
41. Description This command determines the local serial port start stop asynchronous character framing that the DCE uses Values lt format gt 0 Autodetect not supported 1 8 Data 2 Stop supported lt parity gt parameter is ignored 2 8 Data 1 Parity 1 Stop supported If no lt parity gt provided 3 is used by default as lt parity gt value 3 8 Data 1 Stop supported lt parity gt parameter is ignored 4 7 Data 2 Stop supported lt parity gt parameter is ignored 5 7 Data 1 Parity 1 Stop supported If no lt parity gt provided 3 is used by default as lt parity gt value 6 7 Data 1 Stop supported lt parity gt parameter is ignored lt parity gt 0 Odd supported 1 Even supported 2 Mark supported 3 Space supported 4 None supported Note All character framing formats settings of the serial interface i e 801 8E1 8S1 8N1 7N1 701 7E1 7S1 and 7N2 are supported on autobauding operation Syntax Command syntax AT ICF format lt parity gt Command Possible responses AT ICF ICF 3 4 OK Note Current values AT ICF ICF 1 6 0 4 OK Note Possible values AT ICF 2 0 OK Note New values Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 100 Chapter 12 V 24 and V 25 Commands DTE DCE Local Flow Control IFC Description This command is controls the operation of local flow control between the DTE and DCE Values l
42. E2P SIM E2P E Default values amp C X 1 amp D X 2 amp S X 1 E X 1 Q X X 0 V X X 1 4ICF X 3 4 4IFC X 2 2 IPR X 115200 WMUX X X 0 Specific commands 1 0 for VMI 2 0 for MBN 4 0 for DCI 4WCCS X Custom table is the same as pt 89M tebe O to GSM table WCDM HEN es MO se WIOM L CX May be 1023 0 oF 0 0 WRIM To o x T S x WSVG I LewvwR o sp X dt gt k SIM Toolkit commands STSF po X 7 JO MFeBFFFFIFSA GPRS commands GCAUTO X X 3 GCCLASS X B GCDCONT X GCEREP X X 0 GCREG X X 0 GCSMS X 1 WGPRS X 0 1 1 0 3 0 5 0 6 0 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 181 Appendix A Result Codes Failure Causes Other Tables GSM Sequences List In accordance with GSM Technical Specification 02 30 the product supports the following GSM sequences which can be used through the ATD and the CKPD commands Securit 04 OLDPIN NEWPIN NEWPIN Change PIN code 042 OLDPIN2 NEWPIN2 NEWPIN2 Change PIN2 code 05 PUK NEWPIN NEWPIN Unlock PIN code 052 PUK2 NEWPIN2 NEWPIN2 Unlock PIN2 code 06 Show the IMEI number Call Forwarding SC bs or SC PhoneNumber or Register and activate SC PhoneNumber BS or or SC PhoneNumber BS T or or SC PhoneNumber or or SC PhoneNumber BS or SC PhoneNumber BS T SC BS or SC BS or
43. Inc Wireless GSM GPRS AT Commands Document Number S0002931 167 Chapter 15 GPRS Commands GPRS Parameters Customization WGPRS Description This command modifies some of the GPRS parameters e The ATTACH STATUS the modem doesn t automatically make a GPRS attachment after initialization e The PDP INIT STATUS activate automatically some defined PDP Contexts after initialization and e The user defined multislot class This parameter represents the GPRS class chosen by the user to perform power saving by reducing TX or uplink time slots In addition this command allows you to e Automatically set some defined PDP contexts to be activated after initialization e Set some parameters for the PALM OS software PPP Silent Mode PPP waits for PPP Client to start the dialog and Slow CONNECT due to the delay of the processing of PALM OK the CONNECT is sent one second after the dialing command request Important Note The modem must be rebooted to activate the new setup except for mode 3 5 6 and 7 refer to the Values section Values mode 0 1 NO RWND Notes A numeric parameter which specifies a GPRS parameter ATTACH STATUS the modem doesn t automatically make a GPRS attachment after init PDP INIT STATUS declare some PDP contexts liable to be activated automatically after initialization by lt mode gt 2 Set ACTIVABLE automatically after init a define PDP context PPP silent mode Definition o
44. Information Responses and Result Codes Responses start and end with lt CR gt lt LF gt except for the ATVO DCE response format and the ATQ1 result code suppression commands e fthe command syntax is incorrect an ERROR string is returned e fthe command syntax is correct but transmitted with the wrong parameters the CME ERROR lt Err gt or CMS ERROR lt SmsErr gt strings are returned with adequate error codes if the CMEE was previously set to 1 By default CMEE us set to 0 and the error message is only ERROR e fthe command line has been performed successfully an OK string is returned In some cases such as AT CPIN or unsolicited incoming events the product does not return the OK string as a response Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 10 Chapter 3 General Behaviors Chapter 3 General Behaviors SIM Card Insertion and Removal Procedures SIM card Insertion and Removal procedures are supported Software functions rely on positive reading of the hardware SIM detect pin This pin state open closed is permanently monitored When the SIM detect pin indicates that a card is present in the SIM connector the product tries to set up a logical SIM session The logical SIM session will be set up or not depending on whether the detected card is a SIM Card or not The AT CPIN command delivers the following responses e Ifthe SIM detect pin indicates
45. Network Requested PDP Context ACHV atl OR siisii ranne aaa rE s aed FRU ieii 163 Automatic Response to a Network Request for PDP Context Activation CGAUTO ssssseeee 164 Manual Response to a Network Request for PDP Context Activation CGANS ssssseeeneeeee 165 vd Eius MEC UIBpIM T 166 niii R41 pre 166 SSH Reporting Control E Prr UNIC M m 167 Extended Error Repot CBE Ra ise rb EE E PE T REHIR RE ESPERE CERERI RETE ERE ruins dnote RN MEHR VEN GS RAE PRIN 167 GPRS Parameters Customization WOBRS iuis erac rette ERRPEISEEUXR OK KREFEUHEEIEE RAN ERIS U E ENRPER NUR ARN UK REXRHUpMEDER 168 Brita tomo Ree CIPES AT COMMANA AURATA Rx RE EO ani ERR A AT REX D Ape eni 170 Chapter 16 Other AT Commiands riouaccuceie ee enanun antnasnt a Ko aB E CUP I aBEYRR da Rak RUSO CUP a PRERUN UE K Yao a E 171 Aot eve OMI Me CMU ood esuada eR ARD ERZPL Foot o E AERA EEEANAn PAVRAEEADIBKAKH UE VUSER CUIR TE EE A T EE OEE fA DERE Mr 171 io Dr MOS BSc HEIDE cies e EIER PF LIRU MIN ES BU Meu tp uni nai Ma i71 GoM SEI Beosmiriblcialidr asn E E 171 Appendix A Result Codes Failure Causes Other Tables eese nennen nnn nennt 172 Chamar SUNMA Meet 172 ME Error Result Code OME ERROR aO Jessie oaoa Aiea e kA AAE ea AA 173 Message Service Failure Result Code CMS ERROR erre ernannt renta th erae ker e Lb neon Eno aep 174 Specie Enor RESU CodeS mS 174
46. Note 2 messages are unread these messages will then have their status changed to REC READ AT CMGL REC READ Note List read messages in text CMGL 2 REC READ 0146290800 lt CR gt lt LF gt Keep cool mode OK AT CMGL STO SENT OK Note List stored and sent messages Note No message found in text mode AT CMGL 1 CMGL 1 1 26 Note List read messages in PDU lt CR gt lt LF gt mode 07913366003000F3040B913366920547F400130011904125 30400741 AA8E5A9C5201 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 69 Chapter 9 Short Messages Commands Send Message CMGS Description The lt address gt field is the address of the terminal to which the message is sent To send the message simply type lt ctrl Z gt character ASCII 26 The text can contain all existing characters except ctrl Z and lt ESC gt ASCII 27 This command can be aborted using the lt ESC gt character when entering text In PDU mode only hexadecimal characters are used 0 9 A F Values See the Parameters Definition list at the beginning this chapter Syntax Command syntax in text mode AT CMGS da toda CR Text is entered ctrl Z ESC gt Command syntax in PDU mode AT CMGS length CR PDU is entered lt ctrl Z ESC gt Command Syntax AT CMGS Command Possible responses AT CMGS 3314
47. Note If a value is omitted for a particular class then this class is not checked Command Syntax AT CGQMIN Possible Response s AT CGQMIN lt cid gt precedence gt OK lt delay gt lt reliability gt peak ERROR lt mean gt AT CGQMIN CGQMIN lt cid gt lt precedence gt lt delay gt lt reliability gt lt peak gt lt mean gt lt CR gt lt LF gt CGQMIN cid precedence gt delay lt reliability gt peak mean OK AT CGQMIN CGQMIN lt PDP_type gt list of supported lt precedencess list of supported delay s list of supported lt reliability gt s list of supported peak s list of supported lt mean gt s lt CR gt lt LF gt CGQMIN PDP type list of supported lt precedencess list of supported delay s list of supported lt reliability gt s list of supported peaks s list of supported mean s AT CGQMIN 1 1 4 5 2 31 AT CGOMINZ CGQMIN IP 1 3 1 4 1 5 1 9 CGQMIN PPP 1 3 1 4 1 5 1 OK AT CGQMIN CGQMIN 1 1 4 5 2 14 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 154 Chapter 15 GPRS Commands GPRS Attach or Detach CGATT Description Values Syntax The execution command is used to attach the modem to or detach the modem from the GPRS service After the command has completed the modem remains in V 25ter command
48. Read the SMS storage Note No SMS is stored in the Flash AT WMCP 0 OK Note Copy all the SMS from the SIM to the Flash AT CPMS CPMS ME 4 99 ME 4 99 5M 4 10 OK Note Read the SMS storage Note 4 SMS are stored in the Flash More Messages to Send CMMS Description This short message service oriented AT command allows the link to be kept open while sending several short messages with only a short delay Values lt mode gt 0 Disable feature 1 Keep link opened while messages are sent If the delay between two messages exceeds 5 seconds the link is closed and the mode is reset to 0 the feaure is disabled 2 Keep link opened while messages are sent If the delay between two messages exceeds 5 seconds the link is closed but the mode remains set to 2 the feaure is still enabled Notes e IMPORTANT Before sending the last SMS in the link you must use the AT CMSS 0 command This command will indicate that the FOLLOWING SMS will be the last one e The delay of 5 seconds complies with Rec 3GPP 27 005 3 5 6 Syntax Command Syntax AT CMMS lt mode gt Command Possible responses AT CMMS 0 OK Note Disable feature Note Feature is disabled AT CMMS 1 OK Note Enable feature 1 time Note Feature is enabled link is open AT CMMS 2 OK Note Enable feature Note Feature is enabled link is open AT CMMS CMMS 2 OK AT CMMS CMMS 0 2 OK Multi Tech Systems Inc Wireless GSM
49. Select Message Service CSMS sssssus 61 Select Mode FCLASS sssessssssss 94 Select Phonebook Memory Storage CPBS 46 Select Service for MO SMS Messages CGSMS 159 Select TE character set CSCS sssuus 14 Select Voice Gain WSVG sss 121 Selection of Preferred PLMN List CPLS 36 Send Message CMGS sss 70 Send Message from Storage CMSS 72 Service Center Address CSCA ccccccceseeeeestteeeees 74 Service Reporting Control amp CR ss 94 167 Ser DCD Signal QG ursciegsieiedes cer aeks vetus eraccx niisiis 101 Ser DSR OGNA AO s atte itas uides i 102 Ser DIR Signal amp D a rici e ch entitle 102 Set phone functionality CFUN eseeeeees 16 Set Standard Tone WSST sssssssssss 135 Set Text Mode Parameters CSMP ssuus 72 Set Voice Mail Number CSVM sssessssss 56 Settings of a Phonebook Group WPGS 59 Short Messages Commands Parameters Definition 60 Show PDP Address CGPADDR ssssssss 166 Show Text Mode Parameters CSDH 65 SideTone Modification SIDET sissien 30 Sigrial QUA dq SO iuto iti mie cir enapan 3i SIM Application ToolKit Overview 138 SIM Car
50. Subscriber Number CNUM seeseeeeeeenne 55 Supplementary Service Notifications CSSN 89 T TE Terminal EQGUIDITIOLID ziii citat rei aoa ttt coa iecore 9 Terminal EqQuipment TE tiene eibi pano terque bete 9 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 202 U Unsolicited Result Codes sssssesssss 179 Unsolicited Result Diverted Call Indicator WDCI 128 Unsolicited Result SIM ToolKit Control Response STCR M adt 146 Unsolicited Result Voice Mail Indicator WVMI 128 Unstructured Supplementary Service Data CUSD 90 Using Commands During Data Connection 92 V V DCE Response FOTIGL s aoa eso ri ett correnti 103 V42bis Data Compression DS ssssesss 97 V42bis Data Compression Report DR 98 Voice Rate MAU EE 119 WwW Write GPIO Value WIOQW eneenenem 114 Write Language Preference WLPW T3 Write Message to Memory CMGW sss fA Write Phonebook Entry CPBW eeeseeeee 49 Z Z Default GonfigUfallon e peices ior eres tort reip teh 103 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 203
51. Supplementary Services Commands Unstructured Supplementary Service Data CUSD Description The USSD supplementary service is described in GSM 02 90 It is based on sequences of digits which may be entered by a mobile user with a handset A sequence entered is sent to the network which replies with an alphanumerical string for display only or for display plus request for the next sequence This command is used to e Enable or disable the CUSD indication sent to the application by the product when an incoming USSD is received e Send and receive USSD strings Values lt n gt 0 Disable the result code presentation 1 Enable the result code presentation 2 Cancel session not applicable to read command response 0 no further user action required network initiated USSD Notify or no further information needed after mobile initiated operation 1 further user action required network initiated USSD Request or further information needed after mobile initiated operation 2 USSD terminated by network 4 Operation not supported lt str gt is network string converted in the selected character set lt dcs gt is the data coding scheme received GSM TS 03 38 Syntax Command syntax AT CUSD n lt str gt dcs Note In case of enabled presentation a CUSD as direct answer to a send USSD is then indicated with CUSD lt m gt lt str gt lt dcs gt Command Syntax To Send and Receive USSD AT CUSD n lt str gt
52. and the DTMF tone can be stopped by AT WDTMF 0 Command syntax AT WDTMF lt mode gt lt dtmf gt lt gain gt lt duration gt Response syntax OK or CME ERROR lt err gt Command Possible responses AT WDTMF 1 9 50 OK Note Play a DTMF tone Note Done AT WDTMF 0 OK Note Stop playing Note Done AT WDTMF WDTMF 0 1 0 9 A B C D 0 15 0 50 Note Test command OK Note Done AT WDTMF ERROR Note Current value Downloading WDWL Description Values Syntax This command switches the product to download mode AT WDWL allows the download process to launch on UART1 only Downloading is performed using the 1K XMODEM protocol Important Note Software damages may occur if power is lost or if a hardware reset occurs during the downloading phase This would seriously affect the modem No parameters Command syntax AT WDWL Command Possible responses AT WDWL WDWL 0 Note Switch on downloading mode Note Start the downloading Note Downloading in progress AT CFUN 1 Note Reset the product at the end OK Note Reset completed New software running AT WDWL WDWL VO2 12 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 118 Chapter 13 Specific AT Commands Voice Rate WVR Description This command allows the voice rate for bearer voice to be co
53. attempt Note PUK2 correct new PIN2 stored To determine which code must be entered or not the following query command can be used AT CPIN2 The possible responses are CPIN2 READY No PIN2 is needed CPIN2 SIM PIN2 PIN2 is required CPIN2 SIM PUK2 PUK is required CME ERROR err Absent 10 etc PIN Remaining Attempt Number CPINC Description This command gets the number of valid attempts for PIN1 CHV1 PIN2 CHV2 PUK1 UNBLOCK CHV1 and PUK2 UNBLOCK CHV2 identifiers Values lt n1 gt lt n2 gt are the attempts left for PIN1 PIN2 0 blocked 3 max lt k1 gt lt k2 gt are the attempts left for PUK1 PUK2 0 blocked 10 max For this to work the card should be present at the time of initialization otherwise an error will be sent CME ERROR 10 Syntax Command Syntax AT CPINC Response syntax CPINC lt n1 gt lt n2 gt lt k1 gt lt k2 gt Command Possible responses AT CPINC CPINC 2 3 10 10 Note Get the number of attempts left OK Note First CHV1 attempt was a failure AT CPINC CPINC 2 3 10 10 Note Get current values OK Note First attempt was a failure AT CPINC OK Note Get possible values Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 42 Chapter 7 Security Commands Facility Lock CLCK Description This command locks unlocks or interrogates an ME or network facilit
54. 1 2 1 1 12 4 4 5 2 1 2 1 1 When the modem is set in CG class the modem always makes an automatic GPRS attachment after initialization AT WGPRS always gives WGPRS 0 0 for the parameter 0 The default value for mode 7 is 0 In this case no automatic GPRS reconnection to a new operator is done when reaching border areas Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 168 Chapter 15 GPRS Commands Command Syntax AT WGPRS lt mode gt lt parameter gt lt cid gt lt class gt Command Possible Responses AT WGPRS WGPRS mode lt parameter1 gt lt cid gt lt CR gt lt LF gt WGPRS lt mode gt lt parameter gt lt cid gt OK AT WGPRS WGPRS lt mode gt list of supported lt parameters gt list of supported lt cid gt lt CR gt lt LF gt WGPRS lt modes gt list of supported lt parameter gt list of supported lt cid gt OK AT WGPRS 22 1 3 Note Set ACTIVABLE to ON on PDP context 3 OK AT WGPRS 7 1 Note Set automatic re attachment to the network and reactivation of PDP context in case of change of operator for MCC MNC OK AT WGPRS 4 18 Note Choose GPRS multislot class 8 OK AT WGPRS Note Request range of values AT WGPRS 0 7 0 1 0 4 2 8 10 12 OK AT WGPRS Note Automatic re attachment at init not activated Automatic react
55. 15 by default will be used e Values of MCC MNC are set to 0 in the case of No service Syntax Command syntax AT CCED lt mode gt requested dump gt Command AT CCED 0 Note Last request was AT_CCED 0 3 main cell and neighbors 1 to 6 you can see MCC MNC sequences here 208 20 Possible responses CCED 208 20 0002 0418 37 706 24 0 0 208 20 0006 98 9b 37 835 20 208 20 0002 02a9 37 831 12 208 20 0101 79 66 34 818 508 20 0006 9899 39 713 9 208 20 0002 0a72 3 3 711 12 208 20 0101 031b 36 824 10 1 OK AT CCED 0 1 CCED 208 20 0002 0418 37 706 25 0 0 Note Only Main Cell request OK AT CCED 0 1 CCED 208 10 189C 19 85 31 32 0 0 Note Call in progress RxLev and RxQual are OK empty RxLevFull RxLevSub RxQualFull and RxQualSub have data AT CCED 1 8 1 OK CSQ 12 99 CSQ 13 99 AT CCED 0 16 CCED Note idle mode 208 20 0006 0418 54 789 255 0 208 20 0 0006 57 1018 20 208 01 7500 6497 17 55 17 208 10 54c4 f0ed 31 700 9 208 20 0006 7d9a 50 1023 8 208 20 0002 9a29 48 1015 7 Note 1 1 1 2 1 2 correspond to the Main Cell Timing Advance and 5 Neighbors Timing Advance AT CCED 0 16 Note dedicated mode CCED 208 20 0006 0418 54 789 19 19 0 0 41 801 6 57 101 8 20 48 1015 10 57 1006 4 50 1023 7 57 814 3 1 33335 Note Neighbors Timing Advances are not available in dedicated mode AT CCED 1 16 CME ERROR 3 Multi T
56. 2 NEWS 0 OK AT STGR 6 1 1 Select Item 1 OK STIN 3 User request to enter Password sent AT STGI 3 Get information about this request STGI 0 0 4 4 0 Enter Account Password OK AT STGR 3 1 lt CR gt The user enters the Password 0000 Ctrl Z gt OK STIN 1 A text info has been sent from the SIM AT STGI 1 Get information about this text STGI O Password correct please wait for response 0 OK STIN 9 SIM requests a bank account update from bank server via the network SEND SMS AT STGI 9 Get all information about the SEND SMS STGI Send account balance of user authorization ok OK wii After a short period of time STIN 5 Transaction is complete BEEP STGI 5 Get information about the Tone STGI 9 1 1 STIN 1 Display text indication AT STGI 1 STGI 0 Your account balance is 1000 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 148 Chapter 15 GPRS Commands Chapter 15 GPRS commands Important GPRS commands are not available under GSM only software Define PDP Context CGDCONT Description This command specifies PDP context parameter values for a PDP context identified by the local context identification parameter lt cid gt Four PDP contexts can be defined through the software A special form of the set command CGDCONT cid causes the values for context number cid to become undefined The test command
57. 234 OK Note Service center initialization AT CMGS 33146290800 lt CR gt CMGS 1 Happy Birthday lt ctrl Z gt OK Note Note Successful transmission Select Cell Broadcast Message Types CSCB Description This command selects which types of CBMs are to be received by the ME This command is allowed in both PDU and text modes Values The lt bm gt parameter of CNMI command controls the message indication The activation of CBM reception lt mode gt 0 can select only specific Message Indentifiers list in lt mids gt for specific Languages list in lt dcss gt but the deactivation stops any reception of CBMs only AT CSCB 1 is allowed Message Identifiers lt mids gt parameter indicates the type of message identifiers for which the ME should listen lt dcss gt Supported languages 0 for German 8 for Portuguese 1 for English 9 for Finnish 2 for Italian 10 for Norwegian 3 for French 11 for Greek 4 for Spanish 12 for Turkish 5 for Dutch 13 for Hungarian 6 for Swedish 14 for Polish 7 for Danish 32 for Czech Syntax Command Syntax AT CSCB mode lt mids gt lt dcss gt Important Note Test read command AT CSCB is not supported Command Possible responses AT4CSCB20 15 17 50 86 OK Note Accept SMS CB types 15 16 17 50 and Note CBMs can be received 86 in any language CBM 10 lt CR gt lt LF gt 00112233445566778899 Note CBM length of a received Cell Broadcast
58. 83 Calling Line Identification Restriction CLIR 83 Capabilities list e GOAP wisi icc hd a 15 Card Identification CCID ssssessseeessss 15 Cell Broadcast Message Identifiers WCBM 75 Cell Environment Description 4 CCED 107 Cellular Result Codes CRC ss 95 166 Change Default Melody WCDM ess 123 Change Default Player WCDP esssss 130 Change or Do Not Change SMS Status WUSS 77 Change Password CPWD eeseseeeeee 44 Clock Management COLK sese 18 Closed User Group CCUG i iicet 91 Command line AT eee ren ore eee er reer rere er cee per SII NEN tere te 10 Command Type and Next Action Indicator 190 Commands Short Messages New Message Acknowledgement CNMA 61 Commands Call Control Answer a Gall iiu epe t Hem ted 21 Automatic Answer SO sierici rdi T S eR 23 Automatic Dialing with DTR 96D ssss 23 Dial conmniad Dessen nsn a serene errr reer errs 19 DTMF Signals 4V TDs MTS tis ait eati 21 Echo Cancellation ECHO cccessssceeeesseeeteeeeees 27 Extended Error Report CEER wsit ancicnicoinacn 21 Gain Control VGR VGT eee 24 Hang Up cominand blico ii cer pacar bestes 20 Incoming Call Bearer CICB sesssss 24 Initializ
59. A0O 1234 5555 OK Note Change Call Barring password Note Password changed AT CPWD AO 1234 5555 Note Change password CME ERROR 16 Note Wrong password AT CPWD AO 5555 1234 Note Change password OK Note Password changed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 81 Chapter 10 Supplementary Services Commands Call Waiting CCWA Description Values Syntax This command controls the call waiting supplementary service The product will send a CCWA unsolicited result code when the call waiting service is enabled lt n gt result code presentation status in the TA 0 Disable 1 Enable lt mode gt 0 Disable 1 Enable 2 Query status type 0 Type of address byte in integer format refer to Rec GSM 04 08 8 sub clause 10 5 4 7 class 1 Voice 2 Data 8 Short Messages 7 Allclasses voice data Note A combination of different classes is not supported It will only result in the activation deactivation status request for all classes 7 status 0 Not Active 1 Active alpha Optional string type alphanumeric representation of number corresponding to the entry found in the ADN or FDN phonebook Command Syntax AT CCWA n mode class Response Syntax for lt mode gt 2 and command successful CCWA status lt class1 gt lt CR gt lt LF gt CCWA status class2
60. AT CGACT Possible Response s AT CGACT lt state gt OK lt cid gt lt cid gt ERROR AT CGACT CGACT lt cid gt lt state gt lt CR gt lt LF gt CGACT cid state OK AT CGACT CGACT list of supported lt state gt s l OK OK O AT CGACT CGACT 1 1 K AT CGACT CGACT 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 156 Chapter 15 GPRS Commands Enter Data State CGDATA Description Note Values Syntax The command causes the modem to perform the necessary actions to set up communication between the DTE and the network This may include performing a GPRS attach and one PDP context activation If the lt cid gt value is not defined to the modem the modem will return an ERROR or CME ERROR response Otherwise the modem issues the intermediate result code CONNECT and enters V 25ter online data state GPRS attachment and PDP context activation procedures may take place prior to or during the PDP startup if they have not already been performed using the CGATT and CGACT commands If no lt cid gt is given the modem attempts to activate the context with whatever information is available to the modem The other context parameters is set to their default values No APN default QOS parameters dynamic IP address requested If the activation is successful data transfer may proceed After data transfer and lay
61. AT CPBS WIND 4 Y N AT CPBR WIND 4 Y Y AT CPBF WIND 4 Y Y AT CPBW WIND 4 Y N AT CPBP WIND 4 Y Y AT CPBN WIND 4 Y Y AT CNUM WIND 4 Y N AT WAIP WIND 3 N N AT WDCP WIND 4 Y N AT CSVM WIND 4 N N AT WCOS WIND 3 N N AT WPGW WIND 4 N N AT WPGR WIND 4 N Y AT WPGS WIND 4 N Y Short Messages Commands AT commands Conditions SIM dependence Intermediate AT CSMS WIND 16 Y N AT CNMA WIND 16 Y N AT CPMS WIND 16 Y N AT CMGF WIND 3 Y N AT CSAS WIND 3 Y N AT CRES WIND 3 Y N AT CSDH WIND 16 Y N AT CNMI WIND 16 Y N AT CMGR WIND 16 Y Y AT CMGL WIND 16 Y Y AT CMGS WIND 16 Y N AT CMGW WIND 16 Y Y AT CMSS WIND 16 Y N AT CSMP WIND 16 Y N AT CMGD WIND 16 Y N AT CSCA WIND 16 Y N AT CSCB WIND 16 Y N AT WCBM WIND 16 Y N AT WMSC WIND 16 Y Y AT WMGO WIND 16 Y N AT WUSS WIND 3 N N AT WMCP WIND 16 Y N AT CMMS WIND 3 Y N Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 194 Appendix G Conditions for Command Execution and SIM Dependence Supplementary Services Commands AT commands Conditions SIM dependence Intermediate AT CCFC WIND 4 Y N AT CLCK WIND 4 Y N AT CPWD WIND 4 Y N AT CCWA WIND 4 Y N AT CLIR After PIN entered Y N AT CLIP After PIN entered Y N AT C
62. AT WMUX WMUx 0 1 OK AT WMUX WMUX 0 OK Note Data Commands multiplexing disabled AT WMUX 1 OK Note Enable Data Commands multiplexing Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 106 Chapter 13 Specific AT Commands Chapter 13 Specific AT Commands Cell Environment Description CCED Description This command can be used by the application to retrieve the parameters of the main cell and of up to six neighboring cells There are two possible methods for the external application to determine these cell parameters e On request by the application e Automatically by the product every 5 seconds Automatic mode is not supported during registration Values mode 0 One shot requested 1 Automatic shots requested 2 Stop automatic shots requested dump 1 Main Cell e If the Cell Identity is available MCC MNC LAC Cl BSIC BCCH Freq absolute RxLev RxLev Full RxLev Sub RxQual RxQual Full RxQual Sub ldle TS e If the Cell Identity is not available MCC MNC LAC BSIC BCCH Freq absolute RxLev RxLev Full RxLev Sub RxQual RxQual Full RxQual Sub ldle TS 2 Neighbor1 to Neighbor6 e If the Cell Identity is available MCC MNC LAC CI BSIC BCCH Freq absolute RxLev e If the Cell Identity is not available MCC MNC LAC BSIC BCCH Freq absolute RxLev 4 Main Cell Timing Advance Main cell RSSI indications RxLev in a range from 0 to 31
63. CGAUTO lt n gt OK AT CGAUTO CGAUTO 0 3 OK AT CGAUTO CGAUTO 0 2 OK AT CGAUTO CGAUTO 2 OK AT CGAUTO 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 164 Chapter 15 GPRS Commands Manual Response to a Network Request for PDP Context Activation CGANS Description Values Syntax Example The execution command requests the modem to respond to a network request for GPRS PDP context activation which has been signalled to the DTE by the RING or CRING unsolicited result code The lt response gt parameter allows the DTE to accept or reject the request If lt response gt is 0 the request is rejected and the modem returns OK to the DTE If lt response gt is 1 the following procedure is followed by the modem PDP context activation procedures take place prior to or during the PDP startup One cid may be specified in order to provide the values needed for the context activation request During the PDP startup procedure the modem has the PDP type and the PDP address provided by the network in the Request PDP Context Activation message If a cid is given his informations must matching with the PDP type and PDP address in the network request as follows The PDP type must match exactly The PDP addresses are considered to match if they are identical or if the address in the context definition is unspecified If any of this information is in conflict t
64. CMSS lt mem3 gt Preferred memory to which received SMS are to be stored lt mid gt CBM Message Identifier lt mr gt Message Reference lt oa gt Originator Address lt pid gt Protocol Identifier lt pdu gt For SMS GSM 04 11 SC address followed by GSM Technical Specification 03 40 TPDU in hexadecimal format coded as specified in doc 4 For CBS GSM Technical Specification 03 41 TPDU in hexadecimal format lt ra gt Recipient Address lt sca gt Service Center Address lt scts gt Service Center Time Stamp in string format yy MM dd hh mm ss zz Year Month Day Hour Min Seconds TimeZone lt sn gt CBM Serial Number lt st gt Status of a SMS STATUS REPORT lt stat gt Status of message in memory lt tooa gt Type of Address of lt oa gt lt tora gt Type of Address of lt ra gt lt tosca gt Type of Address of lt sca gt lt total1 gt Number of locations for messages in lt mem1 gt lt total2 gt Number of locations for messages in lt mem2 gt lt total3 gt Number of locations for messages in lt mem3 gt lt used1 gt Total number of messages in lt mem1 gt lt used2 gt Total number of messages in lt mem2 gt lt used3 gt Total number of messages in lt mem3 gt lt vp gt Validity Period of the short message default value is 167 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 60 Chapter 9 Short Messages Commands Select Message Service CSMS De
65. DL 22 Remote Disconnection JN ieccoio e irure petet Eph ne pRER ERE 21 Repeat last command AV eeeceeeeseeeeeenneeeeeeneeeeneneeeees 15 Report Mobile Equipment errors CMEE 17 Report Mobile Equipment errors CMEE 17 Request GPRS IP Service D cccsssseeeeesteeeeeeteees 162 Request Identification Information l 105 Request IMSI CIMI ecceeeeeeeeeeeeeeeeteneeseeeeeeneeeeneeeeaes 15 Request Model Identification CGMM 13 Request revision identification CGMR 13 Preset WAS Ii siut EE 135 Restore Factory Settings amp F sesssss 104 Restore Settings CRES eesesesesesess 65 Result Code Suppression Q sssss 102 Result Cades Fitial toit rrt iret t te ip peo 179 Result Codes Intermediate ssssssssse 179 Ring Indicator Mode WRIM eenen 122 S SO Automatic ANSWED ccccccesssceeeeseseeeseseeeeessneeeeees 23 Save Configuration amp W eret eterni 103 Save Settings 4O9 S u ie iori cile etena 65 Scan SWOSGIN i secet tret mS 122 Select Cell Broadcast Message Types CSCB 74 Select Data Compression 96C ssssssssse 97 Select Data Error Correcting Mode N 98
66. EHIR IS A Rn RAM M mm Renae 129 PES EET E a E a uires ed Gba NA prd EDU EE T E BR ZEE AE ENEE MEAM A EUR uL d RA 129 Customer servire Prolls NP uosiai Dead ERR KK Loca Ga ld a cada da del rara cde A a Kd d 130 Customer Slorage Miror M MIS cos ro a rires a b Eds RED RE SEU AE E rr b Er r AE RS o pU EI aRN TAN D 130 Change Delali Player Qt mt DP 130 GPHS Mal Box NUMDOr us cis iscissi ennan ink aa a ea NNN RNS 131 Atema WINE e o A o b EE 132 Wavecom Open AT Gono Command WOPEN csi est raci b eapc ape e AE CQ Edid Ep adu 133 gc ESI Q1 e 135 et Sense Tone VST RELIER em 135 ur AA MU M e RR 136 Mok Band Selen dS MIO seinneann ha eR ER ER rd LISSE Roa ERE err cele A A AERE vd ERAI tty err 137 Chapter 14 SIM VOOM iiu dcibacitiie terio eda dparini oii tia dede d nd tla pacis dui gane EUM Hi IRIS UN Clu del Ua ELE Mee OR GU 138 Cuero or SIE ADDUCI TOO sexe xui nta ienei DHATE EARS Xa RAE Eina EM YEDE ARE nGY LAEEE ERR PIX ke AYER DAR S ctr 138 Messages Exchanged During a SIM Toolkit Operation wcsonscdscascccicasszosecissensecesundsecaseensseasanesacdsseaserssendeetesercesceeatwiads 139 SI Talla COTIBEIS acd ado eR t Rb pERR UE Ra RII e EIN MES IR Ebr S pEpE SIME neaa PE EPI PRESE b EM UNI D FPE epa So ERI Pa Re mack 140 Si TOOK Ser FACIES S TOF eem 140 SIM Toolkit Indication e cad g a ST RL e 142 SIM Peel Ger Informielorm ad TOL La aseo se
67. Entries ssss 47 CPBS Select Phonebook Memory Storage 46 CPBW Write Phonebook Entry eeesesss 49 CPHS CPHS COm ma tid us sees arestenectvssccssesscesenenseestag 126 FOPIN Enter PIN raii eea aia 40 CPIN2 Enter PIN2 ciet eie 42 CPINC PIN Remaining Attempt Number 42 CPLS Selection of Preferred PLMN List 36 CPMS Preferred Message Storage 63 ACPOP POWER Off 3 ctii t ier ac vere lives ee S 16 CPOL Preferred Operator List 37 CPUC Price Per Unit and Currency Table 86 CPWD Change Password sessesseeee 44 CPWD Modify SS Password ssssssssse 81 CR Service Reporting Control 94 167 CRC Cellular Result Codes 95 166 CREG Network Registration sesessss 33 CRLP Radio Link Protocol Parameters 96 3 CSAS Save SCUNGS yi ccicescieisesindocsesscsniveraccedapdceedassundes 65 CSCA Service Center Address sssse 74 CSCB Select Cell Broadcast Message Types 74 CSCS Select TE character set uussss 14 CSDH Show Text Mode Parameters 65 CSMP Set Text Mode Parameters 72 CSMS Select
68. HPLMN _ 333 all outgoing barring service only for deactivation 35 call barring of incoming calls oS O 3514 call barring of incoming calls if roaming 353 all incoming barring service only for deactivation Note Network service codes BS are the same the call forwarding sequences Call Waiting 43 BS 43 BS Check status 43 BS Number Presentation 30 CLIP check status 31 CLIR check status 31 PhoneNumber Suppress CLIR for a voice call 31 PhoneNumber Invoke CLIR for a voice call 76 COLP check status Operator Names Refer to the following documentation e SE13 22 August 2005 e NAPRD10 2 6 8 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 183 Appendix A Result Codes Failure Causes Other Tables CPHS Information Field CPHS Information Description Data Field Bit Field All information 0 None CSP service activated and allocated 1 0 SST service activated and allocated 2 1 Mailbox Number service activated and allocated 3 2 Operator Name Shortform service activated and allocated 4 3 Information Numbers service activated and allocated 5 4 RFU 6 5 RFU 7 6 RFU 8 7 Voice Message Waiting Indicator for Line 1 9 8 Voice Message Waiting Indicator for Line 2 10 9 Data Message Waiting Indicator 11 10 Call Forward Activated Indicator for Line 1 13 12 C
69. Message Service 61 CSNS Single Numbering Scheme 24 2650 Signal Qualily rto derae lost 31 CSSN Supplementary Service Notifications 89 CSVM Set Voice Mail Number susesssss 56 CUSD Unstructured Supplementary Service Data 90 DOPT Others Radio Link Parameters 96 DR V42bis Data Compression Report 98 DS V42bis Data Compression essssss 97 ECHO Echo Cancellation eines 2 FCLASS Select Mode ssssssssssessss 94 GCAPCapabilities list seeesesesseeessss 15 ICF DTE DCE Character Framing 100 IFC DTE DCE Local FLow Control 101 ILRR DTE DCE Local Rate Reporting 95 HPR Fixed DTE BS i etuer otibRria etat SIDET SideTone Modification SPEAKER Speaker amp Microphone Selection 26 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 198 STCR Unsolicited Result SIM ToolKit Control Response nre 146 STGI SIM ToolKit Get Information 143 STGR SIM ToolKit Give Response 146 STIN or STRIL SIM ToolKit Indication 142 STSF SIM ToolKit Set Facilities
70. Note DCE transmits full headers and trailers and Note Command valid verbose response text Default Configuration Z Description This command restores the configuration profile Any call is released Values No parameters Syntax Command syntax ATZ Command _ Possible responses ATZ OK Note Command valid Save Configuration amp W Description This command writes the active configuration to a non volatile memory EEPROM For description of the stored parameters refer to Appendix A Values No parameters Syntax Command syntax AT amp W Command Possible responses AT amp W OK Note Writes current configuration to EEPROM Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 103 Chapter 12 V 24 and V 25 Commands Auto Tests amp T Description Values Syntax Echo E Description Values Syntax This command runs various auto tests lt n gt 0 Perform software auto tests The response will be OK if no software problem is detected EEPROM RAM and ROM checksums otherwise a simple ERROR response is sent 1 Perform the audio loop test close This is used to validate the audio loop microphone to speaker 2 Stopthe audio loop test open This is used to validate the audio loop microphone to speaker Command syntax AT amp T lt n gt Command Possible responses AT amp TO OK
71. Note Perform software auto tests Note No software problem detected all checksums are correct AT amp T1 OK Note Do the audio loop test close Note Command valid AT amp T2 OK Note Stop the audio loop test open Note Command valid This command is used to determine whether or not the modem echoes characters received by an external application DTE n 0 Characters are not echoed 1 Characters are echoed Command syntax ATE lt n gt Command Possible responses ATEO OK Note Characters are not echoed Note Done ATE1 OK Note Characters are echoed Note Done Restore Factory Settings amp F Description Values Syntax This command is used to restore the factory settings from EEPROM It only restores the parameters that can be found in the Parameters Storage table with column AT amp F checked Those parameters are restored in RAM and in E2P overwriting the profile set with AT amp W n 0 Restore factory settings Note No other value is supported Command syntax AT amp F lt n gt Command Possible responses AT amp F OK Note Ask for restoring the factory settings Note Done AT amp FO OK Note Ask for restoring the factory settings Note Done Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 104 Chapter 12 V 24 and V 25 Commands Display Configuration amp V Description Values Syntax
72. Otherwise forward them directly to the TE Forward unsolicited result codes directly to the TE TA TE link specific inband used to embed result codes and data when TA is in on line data mode Sets the result code indication routing for SMS DELIVERs Default is 1 No SMS DELIVER indications are routed SMS DELIVERs are routed using unsolicited code CMTI SM index SMS DELIVERs except class 2 messages are routed using unsolicited code If PDU mode CMT alpha length CR lt LF gt lt pdu gt If text mode CMT lt oa gt lt alpha gt lt scts gt tooa fo pid dcs sca tosca lt length gt lt CR gt lt LF gt lt data gt Class 3 SMS DELIVERs are routed directly using code in lt mt gt 2 Message of other classes result in indication mt 1 Sets the rules for storing the received CBMs Cell Broadcast Message types They depend on the coding scheme text or PDU and the setting of Select CBM Types CSCB commana Default is 0 No CBM indications are routed to the TE The CBMs are stored Default The CBM is stored and an indication of the memory location is routed to the customer application using unsolicited result code CBMI BM index New CBMs are routed directly to the DTE using an unsolicited result code If PDU mode CBM lt length gt lt CR gt lt LF gt lt pdu gt PDU mode If text mode CBM lt sn gt lt mid gt lt dcs gt lt page gt lt pages gt Text mode
73. PlmnOns gt value should be provided as a decimal value 1 1 1 1 1 Example PlmnOns 31 means that the four methods will be used for PLMN names bit field value is 1111 or Ox1F Operation Flow for Field PlmnOns ROM PLMN OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 35 Chapter 6 Network Service Commands Syntax Command syntax AT WOPN lt format gt lt NumOper gt lt lac gt Response syntax WOPN lt format gt lt AlphaOper gt Command Possible responses AT WOPN Note Test command OK AT WOPNS 0 20801 Note Give an operator in numeric format WOPN 0 Orange F OK Note Alohanumeric answer AT WOPN 0 99999 Note Give a wrong operator CME ERROR 22 Note Not found AT WOPNS 0 2081 36 WOPN 0 OrangeF for PLMN names Note Give an operator in numeric format for lac 36 OK Note Alphanumeric answer AT WOPN 3 0 OK Note Erase NITZ PLMN names stored in flash memory AT WOPN 4 WOPN 31 Note Read from EEPROM which method will be OK used for PLMN names AT WOPN 4 lt PlmnOns gt OK Note Write to EEPROM which method will be used Selection of Preferred PLMN List CPLS This command selects one PLMN selector with access technology list in the SIM card that is used by Description AT CPOL command Values lt List gt 0
74. RING Note Incoming call CLIP 0146290800 129 1 800020421 2FFFF Note Incoming call with number and name presentation UCS2 format AT CLIP 0 OK Note Disable CLIP presentation Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 83 Chapter 10 Supplementary Services Commands Connected Line Identification Presentation COLP Description This command controls the connected line identification presentation supplementary service useful for call forwarding of the connected line Values lt n gt Parameter sets shows the result code presentation status in the TA 0 Disable 1 Enable lt m gt Parameter shows the subscriber COLP service status in the network 0 COLP not provisioned 1 COLP provisioned 2 Unknown no network Syntax Command syntax AT COLP lt n gt Response syntax COLP lt n gt lt m gt as response to AT COLP COLP lt number gt lt type gt lt subaddr gt lt satype gt alpha After ATD command before OK or CONNECT lt speed gt Command Possible responses AT COLP 1 OK Note Activate COLP Note Command valid AT COLP COLP 1 1 Note Ask for current OK functionality Note COLP is enabled and provisioned ATD146290928 COLP 0146290928 129 JOE Note Outgoing call or COLP 0146290800 129 1 8000204212FFFF UCS2 format OK Note Connected outgoing line number and name pr
75. SMS Status WUSS cicccccisercidacsavslactoscesaceascooiaesensacassapajackeanssddeaaregadeuneonddncnadersenecdiae T7 GOY Messages ANMP sisipin aiea S oiu DOLI EC Oi LER LR NN RRR IRIERE 78 lioe Messages ip Sond GNIS iieri resncizassctesarataiaigea E one ti edel Ee tha detta aseda ea dea cda dE 79 Chapter 10 Supplementary Services Commands eee ssiesesesseeseeei nnne nena nn nnn nnn ne nn na nhan nnn nene 80 cal Forwarding FOC F G c c 80 call Bamna moe Ronin E N OE E we Mt 81 Mady Sa VN FOFWD eI RT TEE NEU I LIU T 81 ESSE UC Ignis fusa Te ret d EUXON UM MON erect ERE ED eer ert tentrere RU CELO ERLEBEN DURUM HON IA E ECOLE CE EHE 82 Calling Line Identification Restriction OL RL uiii eene rtr kinh tue than a a aiaiai thx a eui has eaii 83 Calling Line Identiicaton Presentation SOLIP sireenin ia i dra Ub dp ERR dd Ke RE URGE 83 Connected Line Identification Presentation COLP sesssessssseseesseeeneeeen nennen nnne a ar eii nennen nnne 84 PRG Ot MANA NEU ip pm 85 en nno all Motor CACM e 85 Accumulated Call Meter rr Ei TT 86 Price Per Unibond GC rrenoy Table OP o s EE A M eae ae REA puri PIER 86 Gall Related Supplementary Services OBL rrr arre peser rr S IIREEE HEP DER REA RAT PERRA E SY MNES E PER RUE PR MER RETE 87 Hi pellcc ReC c sa c Q 88 Supplementary Sonica NONTGRTIDRE POSSI us pd zuixE rper TEE KRMERERRER n
76. SPEAKER 517 SIM Toolkit facility not supported STGI 518 SIM Toolkit indication not received STGI 519 Reset product to activate or change a new echo cancellation ECHO VIP algo 520 526 527 528 529 531 SMS not sent the da is not in FDN phonebook and FDN lock CMGS CMSS CMS ERROR 531 is enabled for SMS 532 533 536 Class locked A command has been launched from a port The All commands effect is to lock all commands belonging to the same class If another port launches a command of this class this error will occur as long as the class is not released at first command s completion ti i i 537 538 539 541 Open ATO application and AT software version do not match 543 CMUX connection is refused by remote after a restart of CMUX CMUX protocol by the modem due to a 27 010 connection loss during virtual channels establishment C1 o continued on next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 174 Appendix A Result Codes Failure Causes Other Tables Continued Specific Error Result Codes lt error gt Meaning 1 Results from the following commands 544 CMUX connection Timeout no answer from the remote i e no CMUX DLCO opened response 545 A CMUX session has been started on a physical UART and the CMUX user tries to start another CMUX session on another physical UART The error CME ER
77. Service SMS Point to Point PP 5 ETSI GSM 03 38 Digital cellular telecommunications system Phase 2 Alphabets and language specific information 6 ETSI GSM 04 80 Digital cellular telecommunications system Phase 2 Mobile radio interface layer 3 Supplementary service specification Formats and coding Definitions The words Mobile Station MS or Mobile Equipment ME are used for mobile terminals supporting GSM services Terminal Equipment TE is the Man Machine Interface of a GSM device modem or handset A TE can be a hanset MMI or the AT Command interface A call from a GSM mobile station to the PSTN is called a mobile originated call MOC or outgoing call and a call from a fixed network to a GSM mobile station is called a mobile terminated call MTC or incoming call In this document the word product refers to any Multi Tech product supporting the AT commands interface Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 9 Chapter 2 AT Command Features Chapter 2 AT Command Features Line Settings A serial link handler is set with the following default values factory settings e Autobaud e 8bits data e 1 stop bit e no parity e RTS CTS flow control Please use the IPR IFC and ICF commands to change these settings Command Line Commands always start with AT which means ATtention and finish with a CR character
78. User controlled PLMN selector with access technology EF PLMNwAct Note if this file is not found EF PLMNSel will be selected 1 Operator controlled PLMN selector with access technology EF OPLMNwAct 2 Home PLMN selector with access technology EF HPLMNwAct Syntax AT CPLS List Note Get possible values Command Possible responses AT CPLS CPLS 1 OK Note Ask for selection of the SIM file Note EF OPLMNwAct is selected AT CPLS 0 Note if EF PLMNwAct is not present EF_PLMNsel will be Note selection of EF PLMNwAct selected AT CPLS 1 CME ERROR 3 Note selection of EF OPLMNwAct Note EF OPLMNwAct is not present AT CPLS CPLS 0 1 2 OK Note The 3 files with Acces technology are present and can be selected AT CPLS Note Get possible values CPLS 0 OK Note Only EF PLMNwAct or EF_PLMNsel can be selected Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 36 Chapter 6 Network Service Commands Preferred Operator List CPOL Description Values Syntax This command edits or updates the SIM preferred list of networks This list is read in the SIM file selected by the command AT CPLS lt index gt position of the operator record in the Sim preferred operator list Use AT CPOL to view the maximum index of the selected EF lt format gt 0 long alphanumeric format for lt oper gt 1 short alphanumeric format for lt oper gt 2 numeri
79. Write GPIO Value mmm 114 ES Ugo WGC eT 125 WLPR Read Language Preference 113 WLPW Write Language Preference 113 WMBN CPHS Mail Box Number ncen 131 WMBS Multi Band Selection 197 WMCP Copy Messages eeem 78 WMIR Customer Storage Mirror 130 WMSC Message Status Modification 75 WMUX Multiplexing Mode esess 106 WNON Network Operator Name ses 129 WOLM Operator List Management 33 WOPEN Open AT Control Command 133 WOPN Read Operator Name eeeesesse 34 WPCS Phonebook Character Set 14 WPGS Settings of a Phonebook Group 59 WPGW Create and Delete a Phonebook Group 57 WPGW Read a Phonebook Group 58 WRIM Ring Indicator Mode eeeeseees 122 WRST Reset eee enemies 135 SWSCAN SEOITazi i itecei exi it ndistes S 122 WSST Set Standard Tone eeuuussss 135 ZWSTR Status Hequesl coconut eei oce ctecs 121 WSVG Select Voice Gain euueessss 121 ZWTONE Play TOlQ cies ccce trate tarot resto acordes 117 WUSS Change or Do Not Change SMS Status
80. a SIM card When EF ECC file is missing from SIM 112 and 911 When SIM includes an EF ECC file 112 911 and any emergency numbers available in the EF ECC file International Numbers For an international number the local international prefix does not need to be set usually 00 but does need to be replaced by the character Example to set up a voice call to Multi Tech offices from another country the AT command is ATD 17637853600 Some countries regions may have specific numbering rules for their GSM handset numbering Values lt nb gt Destination phone number lt I gt Optional parameter lt I gt means invocation restrict CLI presentation lt i gt means suppresssion allow CLI presentation lt mem gt Phonebook one of SM LD MC ON ME RC MT or SN A default value can be selected by using the CPBS command lt index gt Call number at indicated offset from the phonebook selected by the CPBS command lt name gt Call number corresponding to given name from the phonebook selected by the CPBS command The response to the ATD command is one of the following Verbose result code Numeric code Description with ATVO set oK O ifthe call succeeds for voice call only CONNECT speed 10 11 12 13 14 15 if the call succeeds for data calls only speed takes the value negotiated by the product BUSY If the called party is already in communication NO ANSWER 8 If no hang up is d
81. absent the response to AT CPIN is CME ERROR 10 SIM not inserted e Ifthe SIM detect pin indicates present and the inserted Card is a SIM Card the response to AT CPIN is CPIN xxx depending on SIM PIN state e fthe SIM detect pin indicates present and the inserted Card is not a SIM Card the response to AT CPIN is CME ERROR 10 e These last two states are not given immediately due to background initialization Between the hardware SIM detect pin indicating present and the previous results the AT CPIN sends CME ERROR 515 Please wait init in progress When the SIM detect pin indicates card absence and if a SIM Card was previously inserted an IMSI detach procedure is performed all user data is removed from the product Phonebooks SMS etc The product then switches to emergency mode When the hardware SIM detect pin is not managed the software cannot know the state of the SIM SIM inserted or SIM removed except for the initialization of the modem In this case the SIM must be present in the rack before the initialization of the modem can be taken into account If the SIM is removed and it had been detected at the time of initialization of the modem the following message is displayed CME ERROR 13 If the SIM is inserted in the rack and it was not present at the time of the initialization of the modem the state of the SIM remains unchanged SIM removed It will have to initialize the modem
82. address may be read using the xCGPADDR command d comp a numeric parameter that controls PDP data compression 0 Off default if value is omitted 1 On Other values are reserved h comp a numeric parameter that controls PDP header compression 0 Off default if value is omitted 1 On Other values are reserved Notes e The data compression algorithm V 42bis provided in SNDCP is V 42bis e Four CIDs are available to specify four PDP contexts but only 11 NSAPIs are available for PDP activation Only one can be activated at a time Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 149 Chapter 15 GPRS Commands Syntax Command Syntax AT CGDCONT Command Possible responses AT CGDCONT lt cid gt lt PDP_type gt OK lt APN gt lt PDP_addr gt lt d_comp gt ERROR h comp AT CGDCONT CGDCONT cid PDP type lt APN gt lt PDP_addr gt data comp head comp lt CR gt lt LF gt CGDCONT cid PDP type lt APN gt lt PDP_addr gt data comp head comp OK AT CGDCONT CGDCONT range of supported cid s PDP type list of supported d comp s list of supported lt h_comp gt s lt CR gt lt LF gt CGDCONT range of supported cid s PDP type list of supported lt d_compss list of supported lt h_comp gt s CGCONT 1 4 IP 0 1 0 1 CGCONT 1 4 PPP 0 0 0 CGCONT 1 I
83. amp V uic nce iet 105 DL Redial Last Telephone Number 22 Downloading WEDNWL ertet 118 DTE DCE Character Framing ICF 100 DTE DCE Local Flow Control IFC 101 DTE DCE Local Rate Reporting ILRR 95 DTMF Signals VTD VTS ssssssssssee 21 E A fo esscxcuubneUiueu EDI 104 ied sagem TT TTE 104 Echo Cancellation 3KEGTIQ eue eet 27 Enter Data State CGDATA sees 157 i ec PINs re e deter eee teres 40 Enter PINS G PIN iisisti rotes droit etm rede 42 Extended Error Report CEER 21 167 F Facility Lock OO IE cs occi ti eet peste festina tee 43 Failure aH SB icc itid EEG SM HMM 176 Find Phonebook Entries CPBF ssssss 52 Fixed DTE Rate IP iui ipu He as 99 G Gain Control SEVA MOT su tco ec Erie tI ce ede oe eek 24 General Indications amp WIND esee 109 GPRS AT Command Examples sss 170 GPRS Attach or Detach CGATT ssseess 155 GPRS Event Reporting CGEREP 160 GPRS Mobile Station Class CGCLASS 158 GPRS Network Registration Status CGREG 161 GPRS Parameters Customization WGPRS 168 GSM Call Forwarding Sequences List 182 GSM Call Waiting Sequen
84. as used in CAOC CACM and CAMM into currency units SIM PIN2 is required to set the parameters If setting fails in an ME error CME ERROR err is returned Values currency String type lt ppu gt String type lt pin2 passwd gt String type Syntax Command syntax AT CPUC lt currency gt lt ppu gt lt pin2 passwd gt Command Possible responses AT CPUC FFR 0 82 1234 OK Note Request Currency and Price per unit update AT CPUC FFR 0 82 1111 CME ERROR 16 Note Request Currency and PPU update wrong PIN2 Note Incorrect password AT CPUC CPUC FFR 0 82 Note Request Currency and Price OK Note Currency FFR Price per unit 0 82 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 86 Chapter 10 Supplementary Services Commands Call Related Supplementary Services CHLD Description This command manages call hold and multiparty conversation conference call Calls can be put on hold recovered released or added to a conversation Values lt n gt 0 Release all held calls or set User Determined User Busy UDUB for a waiting call 1 Release all active calls if any exist and accepts the other held or waiting call 1x Release a specific call X active held or waiting 2 Place all active calls if any exist on hold and accepts the other held or waiting call 2x Place all active calls on hold except call X with w
85. be overwritten e The location number is not kept over a software reset lt loc gt Flash memory capacity Command Syntx AT WMGO loc Location number of the SIM record to write or overwrite The number depends on the SIM or Command Possible responses AT CPMS Note Check the storage area CPMS SM 3 10 SM 3 10 SM 3 10 AT CMGW 33146290800 lt CR gt Hello how are you lt ctrl Z gt Note Write a message in text mode CMGW 4 OK Note Message stored in index 4 in the SIM AT WMGO WMGO 1 10 OK Note Possible values for the SIM AT WMGO 4 AT CMGW 33146299704 lt CR gt You are overwritten lt ctrl Z gt CMGW 4 OK Note New Message stored in index 4 AT WMGO WMGO 4 OK Note The value was used so re initialization AT WMGO 4 OK AT CPMS SM ME SM CPMS 3 10 0 99 3 10 OK Note Change the storage area from SIM to Flash AT WMGO WMGO 1 99 OK Note Possible values for Flash AT WMGO WMGO 0 OK Note We changed the storage area so the value was reinitialized AT WMGO 999 CMS ERROR 321 Note If the storage area is changed with the AT CPMS command the value of WMGO will be reset to zero Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 76 Chapter 9 Short Messages Commands Change or Do Not Change SMS Status WUSS Description The
86. call is allowed without SIM Note The error codes CME ERROR 546 and CME ERROR 547 are only returned if the SIM is not present The fact that network support emergency call CME ERROR 547 does not imply that emergency call without the SIM is working To find out if it is working is to use the ATD112 command Response Syntax for AT COPS COPS mode format oper Response Syntax for AT COPS COPS list of supported lt stat gt long alphanumeric oper short alphanumeric lt oper gt s numeric lt oper gt s Notes e Ifan incoming call occurs during a PLMN list request the operation is aborted CME ERROR 520 and the unsolicited RING appears e If SPN Service Provider Name is present in the SIM it will be returned in both long and short alphanumeric lt oper gt fields The string in the short field will be the SPN truncated to the appropriate character number The following operations are allowed with the SIM inserted or the PIN activated AT COPS Get Current PLMN AT COPS List allowed PLMN AT COPS 1 2 lt plmn gt Manually set current PLMN Command Possible responses AT COPS COPS 0 2 20801 Note Ask for current PLMN OK Note Home PLMN is France Telecom Orange AT COPS COPS 2 F SFR SFR 20801 3 F BOUYGUES TELECOM BYTEL 20820 3 Orange F Orange 20801 Note Ask for PLMN list OK Note Home PLMN is France Telecom SFR BYTEL and O
87. command that is described in ITU T V 25ter Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 163 Chapter 15 GPRS Commands Automatic Response to a Network Request for PDP Context Activation CGAUTO Description Values The set command disables or enables an automatic positive response auto answer to the receipt of a Request PDP Context Activation message from the network It also provides control over the use of the V 25ter basic commands S0 A and H for handling network requests for PDP context activation The setting does not affect the issuing of the unsolicited result code RING or CRING The test command returns values of lt n gt supported by the modem as a compound value When the CGAUTO 0 command is received the modem will not perform a GPRS detach if it is attached Subsequently when the modem announces a network request for PDP context activation by issuing the unsolicited result code RING or CRING the DTE may manually accept or reject the request by issuing the CGANS command or may simply ignore the network request When the CGAUTO 1 command is received the modem will attempt to perform a GPRS attach if it is not already attached Failure will result in ERROR or if enabled CME ERROR being returned to the DTE Subsequently when the modem announces a network request for PDP context activation by issuing the unsolicited result code RING or CRING to the DTE this is follo
88. does not provide causes for actions it takes thus the precise cause for a message which is being sent cannot be ascertained Note All values other than specified should be treated as error 41 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 178 Appendix A Result Codes Failure Causes Other Tables Unsolicited Result Codes Verbose Result Code Numeric Description VO set CALA time string gt lt index gt Alarm notification CBM lt length gt lt pdu gt PDU or As verbose Cell Broadcast Message directly displayed CBM lt sn gt lt mid gt lt dcs gt lt page gt lt pages gt Text mode CBMI BM lt index gt As verbose Cell Broadcast Message stored in mem at location lt index gt CCCM lt ccm gt Current Call Meter value CCED lt values gt As verbose specific Cell Environment Description indication CCWA lt number gt lt type gt class lt alpha gt Call Waiting number CDS fo mr text mode As verbose SMS status report after sending a SMS or CDS length PDU CDSI lt mem gt lt index gt As verbose Incoming SMS Status Report after sending a SMS stored in mem SR at location lt index gt or CMT lt alpha gt PDU location index As verbose specific SIM Toolkit Indication Specific unsolicited indication SIM Insert Remove End of init Reset Alerting Call creation relea
89. format Therefore only the following set of characters is allowed 01 2 8456 789 A B C D E F Each pair of characters is converted to a byte e g 41 is converted to the ASCII character A whose ASCII code is 0x41 or 65 In Text mode all commands and responses are in ASCII characters The format selected is stored in EEPROM by the CSAS command lt mode gt PDU or Text Mode 0 PDU mode 1 Text mode The pdu message is composed of the SC address 00 means no SC address given use default SC address read with CSCA command and the TPDU message In this example the length of bytes of the TPDU buffer is 14 coded according to GSM Technical Specification 03 40 In this case the TPDU is 0x01 0x03 0x06 0x91 0x21 0x43 0x65 0x00 0x00 0x04 0xC9 OxE9 0x34 OxOB which is GSM 03 40 lt fo gt 0x01 SMS SUBMIT no validity period lt mr gt TP MR 0x03 Message Reference lt da gt TP DA 0x06 0x91 0x21 0x43 0x65 destination address 123456 pid TP PID 0x00 Protocol Identifier dcs TP DCS 0x00 Data Coding Scheme 7 bits alphabet length TP UDL 0x04 User Data Length 4 characters of text TP UD 0xC9 OxE9 0x34 0x0B User Data ISSY TPDU in hexadecimal format must be converted into two ASCII characters e g an byte with hexadecimal value 0x2A is presented to the ME as two characters 2 ASCII 50 and A ASCII 65 Command Syntax AT CMGF lt mode gt Command Possible
90. gt CPBR lt loc gt lt num gt lt type gt lt name gt lt Phb_group gt e The entry is stored in the Mobile Equipment phonebook and AT WCOS 0 lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the Mobile Equipment phonebook and AT WCOS 1 lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt lt Contact gt lt Phb_group gt lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt lt Contact gt lt Phb_group gt Command Possible responses AT CPBR CPBR 1 50 20 10 Note Test command OK Note 50 locations from 1 to 50 max length for phone number is 20 digits 10 characters max for the text AT WCOS WCOS 0 Note Test command OK Note Contact not selected AT CPBR 12 14 CPBR 12 112 129 Emergency Note Read entries from 12 CPBR 13 4 331290909 145 Fred to 14 CPBR 14 70146290808 129 Zazi OK Note Display locations 12 13 14 with location number type TON NPI Text AT CPBR 10 CPBR 10 0146290921 129 Rob Note Read entry 10 OK Note Display location 10 AT CPBR 11 CPBR 11 0146290921 129 8000010002FFFF Note Read entry 11 UCS2 OK format Note Display location 11 AT CPBR 52 CME ERROR 21 Note Read entry 52 wrong Note Invalid index AT CPBS ME OK Note Flas
91. ica e ad ci ort Roe Cede cH IS nad ceceastadiaeeherliciehclaumceweraianelendactinemen 143 Unsolicited Result SIM Toolkit Control Response S TGR iussit rn rrt nti trn d th dne enr 146 SIM TaclkivGive Response 457 GR apie aie Nee ee 146 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 6 Table of Contents Chapter 15 GPRS commands issedn ea aA Eaa Aa 149 Deine POP Context POOGDOOMT sise onm SIRE Per eb IM hari ME 149 Quality of Service Pronle Requesied CGQOQREQ ioira Areara ena EEEn RENES EE HAR EEA E HARE ERA ER NiE 151 Quality of Service Profile Minimum Acceptable CGQMIN eeseseseeeeeeeeeneeenneennene nennen nnne nnns 154 GPRS Atach or Dotdch JOGAT ge E 155 PDP Context Activate or Deactieale JOQUNGT sicccasciscciaicinsmeriacorisecinsnpneatccanciuscernienomsediscuebeisesscninecatacestsieaaeoiave 156 Enter Data State GA Ay sc seek cicada dames 187 GPRS Mobile Station Class OO LABS uisi esie rrt EXHI FOPEIRIA RESI FEIE SER ERN TINCE PERI EGRE YR Urb MI ET rc TE TE E CH RR E FEIN 158 Select Service for MO SMS Messages CGSMS ssssseseeeeeeiee enne nennen nnne tnn r tnnt nnns 159 GPRS Evel Re poring FOGEREP passiin t EM eR e ERE VEXEE RARE ELA RA XR GR ELA En iiia aiaiai a ia 160 GPRS Network Registration Statue SQUOBEQL un iiia e E RR a bk iiiaae aia aiai aieeaii daid UNA EAR AUR 161 Preis ar Pie IP Servibe Eas dsunaebus bob a aa a ia REM ATE Bid Anc Rae Ua d dc 162
92. ieicini se atis di cabib REA EEE EE dora RE ERE EE 42 care Wee eg euentu ME 43 ohano PAS SKE SA PID t 44 Chapter e Phonebook CODBITTDOEIS iecicsdiccrecssasscuccescntaasdnragucs Aa aa a 45 introduction to Phone DOO Commands aaa cccrnixisctcaiedsecsaietorciadecues eiiie nna Ea aE i an ea en aE 45 About the Paramete sonecnnesnsnn nne A QURE E E 45 Select Phonebook Memory Storage OP BS eninin nE EEEN 46 Read Phonebook Enies ORBE nueina aA E RPAEEU HERI EC P GE SUE 47 We Phoebo EID SGEBUL E ETE A DOR REEREAKLRER EXE CEREEZ EA Dui writer AA RA ADAE TR ERA E EXE 49 eats POOSDEDODECENITIBE dii cs 3 se cusana Ate ER HE ai Ek E RAE FRAAEVRKCE Id xa A RAE REN in ei CEU a au t E T Bac RA 52 Phonebook Phone Soden Koi THREE 53 Move Aciion im Phonebook ec PIN siaaa E A A EE ENAS 54 subsenber Number SENIIBE nn OEE E E 55 Avold Phonebosk Inializaton WAP e 56 Delete Gals Phono OOK WDO Et 56 sr ei e EE 56 CORA celeco IU Aa P nnwnBFS X X Ob ERE 57 Create and Delete a Phonebook Group WPOW aiu remet rir teret t nections erarteisece eE ai E S pte EUER MCI FRE eee 57 Fiend a Phonebook Group VEER ases tries veis ais asekx URP e pet usas er E xi EN FERT EPI ME pP RN PM QUIE 58 Setiings or a Phonebook Group FWP GS Liu asian cb taeg PARA KE E ru ERAD IA E ERU A AE LEA RA REUNIR EAR URINE ER LE LA EI FAM RR 59 Chapter 9 Short Messages aui imei cci emen nra Gib eint con i pido CR ROM RR RR ECRIRE UE 60 Paremete DOM BONIS ccce ina na tr
93. is optional if lt mode 0 It is mandatory if lt mode gt 1 0 All refused Incoming call is forwarded to the voice mailbox 1 All accepted Incoming call is received RING message is displayed Syntax Command Syntax AT WPGS lt mode gt lt index gt lt restrict call gt Command Possible responses AT WPGS 1 1 1 OK Note Set restrict call to All Accepted AT WPGS 0 1 WPGS 1 Note Read group 1 settings OK Note Group1 all accepted AT WPGS WPGS 0 1 1 10 0 1 Note Test command OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 59 Chapter 9 Short Messages Commands Chapter 9 Short Messages Parameters Definition da Destination Address coded according to the GSM Technical Specification 03 40 TP DA dcs Data Coding Scheme coded according to document 5 lt dt gt Discharge Time in string format yy MM dd hh mm ss zz Year 00 99 Month 01 12 Day 01 31 Hour Minute Second and Time Zone quarters of an hour lt fo gt First Byte coded according to SMS SUBMIT first byte in document 4 default value is 17 for SMS SUBMIT lt index gt Place of storage in memory lt length gt Text mode CMGF 1 number of characters PDU mode CMGF 0 length of the TP data unit in bytes lt mem1 gt Memory used to list read and delete messages CMGL CMGR and CMGD lt mem2 gt Memory used to write and send messages CMGW
94. letter KA e Byte 8 contains the value FF but as the string length is 5 this a valid character in the string where the bit pattern 111 1111 is added to the base pointer yielding a sixteen bit value of 0000 1001 1111 1111 for the UCS2 character e g O9FF e Byte 9 contains the padding value OxFF 3 Ifthe first byte of the alpha string is set to 0x82 then the second byte contains the length of the string number of characters The third and fourth bytes contain a 16 bit number that defines the complete 16 bit base pointer to a half page in the UCS2 code space for use with some or all of the remaining bytes in the string The fifth and subsequent bytes in the string contain coding as follows e f bit 8 of the byte is set to zero the remaining 7 bits of the byte contain a GSM Default Alphabet character e f bit 8 of the byte is set to one the remaining 7 bits are an offset value added to the base pointer defined in bytes three and four and the resultant 16 bit value is a UCS2 code point and defines a UCS2 character Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 191 Appendix E Coding of Alpha Fields in the SIM for UCS2 Example 3 In the above example e Byte 2 indicates there are 5 characters in the string e Bytes 3 and 4 contain a sixteen bit base pointer number of 0530 pointing to the first character of the Armenian character set e Byte 5 contains a GSM Default Alphabet cha
95. like RING at 9600 baud Set Phone Functionality CFUN Description Values Syntax Selects the mobile station s level of functionality When the application wants to stop the product with a power off or if the application wants to force the product to execute an IMSI DETACH procedure then it must send AT CFUN 0 equivalent to AT CPOF This command executes an IMSI DETACH and makes a backup copy of some internal parameters in SIM and in EEPROM The SIM card cannot then be accessed If the mobile equipment is not powered off by the application after this command has been sent a re start command AT CFUNS 1 will have to issued to restart the whole GSM registration process If the mobile equipment is turned off after this command then a power on will automatically restart the whole GSM process The AT CFUN 1 command restarts the entire GSM stack and GSM functionality a complete software reset is performed All parameters are reset to their previous values if AT amp W was not used If you write entries in the phonebook CPBW and then reset the product directly AT CFUN 1 with no previous AT CFUN 0 command some entries may not be written the SIM task does not have enough time to write entries in the SIM card In addition the OK response will be sent at the last baud rate defined by the IPR command With the autobauding mode the response can be at a different baud rate it is therefore preferable to save the defined ba
96. link layer failure at the remote user user equipment off line etc 28 Unidentified subscriber The subscriber is not registered in the PLMN e g IMSI not known 29 Facility rejected The facility requested by the Mobile Station is not supported by the PLMN 30 Unknown subscriber The subscriber is not registered in the HLR e g IMSI or directory number is not allocated to a subscriber 38 Network out of order The network is not functioning correctly and the condition is likely to last a relatively long period of time e g immediately reattempting the short message transfer is not likely to be successful 41 Temporary failure The network is not functioning correctly and the condition is not likely to last a long period of time e g the Mobile Station may wish to try another short message transfer attempt almost immediately 42 Congestion The short message service cannot be serviced because of high traffic 47 Resources unavailable This cause is used to report a resource unavailable event only when no other unspecified cause applies 50 Requested facility not The requested short message service could subscribed 69 Requested facility not The network is unable to provide the requested short message service implemented 81 Invalid short message The equipment sending this cause has received a message with a short transfer reference value message reference which is not currently in use on the MS network interface 95 Invalid message
97. list all alarms CALA 00 06 08 15 25 00 1 CALA 00 06 09 07 30 00 2 CALA 00 06 10 23 59 00 3 Note three alarms are set index 1 2 3 CALA 00 06 08 15 25 00 1 Note an alarm occurs index 1 AT CALA 3 OK Note delete alarm index 3 Note Alarm index 3 deleted AT CALA CALA 00 06 09 07 30 00 2 Note list all alarms Note Only one alarm index 2 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 18 Chapter 5 Call Control Commands Chapter 5 Call Control Commands Dial Command D Description The ATD command sets a voice or data call As per GSM 02 30 the dial command also controls supplementary services Data Calls For a data call the application sends the following ASCII string to the product the bearer must be previously selected with the CBST command ATD lt nb gt where nb is the destination phone number Note If a GPRS PPP session is already running the setting of CSD GSM data call is not supported Voice Calls For a voice call the application sends the following ASCII string to the product the bearer may be selected previously if not a default bearer is used ATD lt nb gt where nb is the destination phone number Emergency Calls For emergency calls These Emergency Numbers are available without a SIM card 000 08 110 112 118 119 911 and 999 These Emergency Numbers are available with
98. lt CR gt lt LF gt CGPADDR lt cid gt lt PDP_addr gt OK AT CGPADDR CGPADDR list of defined lt cid gt s OK In this example 1 lt cid gt is defined AT CGPADDR 1 CGPADDR 1 107 210 5 4 OK AT CGPADDR CGAPDDRa 1 OK AT CGPADDR CGPADDR 1 Cellular Result Codes CRC Description Values Syntax This command enables a more detailed ring indication in case of incoming call voice or data Instead of the string RING an extended string is used to indicate which type of call is ringing e g CRING VOICE These extended indications are CRING ASYNC for asynchronous transparent CRING REL ASYNC for asynchronous non transparent CRING VOICE for normal speech CRING GPRS GPRS network request for PDP context activation If the modem is unable to announce to the DTE the network s request for example it is in V 25ter online data state the modem reject the request No corresponding unsolicited result code is issued when the modem returns to a command state No parameters Command Syntax AT CRC Command Possible responses AT CRC 0 OK Note Extended reports disabled Note Command valid AT CRC 1 OK Note Extended reports enabled Note Command valid AT CRC CRC 1 OK AT CRC CRC 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 166 Chapter 15 GPRS Commands Service Reporting Con
99. lt class gt lt subaddr gt lt satype gt lt time gt Response syntax CCFC status lt class1 gt number type lt subaddr gt lt satype gt lt time gt lt CR gt lt LF gt CCFC status lt class2 gt numbers type lt subaddr gt lt satype gt lt time gt Command Possible responses AT CCFC 0 3 0146290800 OK Note Register to an unconditional call forwarding Note Command valid AT CCFC 0 2 CCFC 1 1 0146290800 129 Note Interrogate unconditional call forwarding Note Call forwarding active for voice lt CR gt lt LF gt CCFC 1 2 0146290802 129 Note Call forwarding active for data lt CR gt lt LF gt CCFC 1 4 0146290804 129 OK Note Call forwarding active for fax AT CCFC 0 4 OK Note Erase unconditional call forwarding Note Command valid CCFC responses are not sorted by lt class gt parameter but only by the order of network response Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 80 Chapter 10 Supplementary Services Commands Call Barring CLCK Description This command allows control of the call barring supplementary service Locking unlocking or querying the status of call barring is possible for all classes or for a specific class but not for a combination of some Values lt fac gt AO Ol OX barring outgoing calls Al IR bar
100. number stored in the first location of the ADN phonebook or FDN phonebook if it is activated using the CLCK command e Automatic sending of the short message SMS stored in the first location of the SIM The number is dialed when the DTR OFF switches ON The short message is sent when DTR OFF switches ON Values n 0 2 Enables or disables automatic message transmission or number dialing Informs the product that the number is a voice number rather than a data number D0 Disables automatic DTR number dialing message transmission D1 Enables automatic DTR dialing if DTR switches from OFF to ON Dials the phone number in the first location of the ADN phonebook or FDN phonebook if it is activated using the CLCK command Voice call with semicolon D1 Activates automatic DTR dialing if DTR switches from OFF to ON Dials the phone number in the first location of the ADN phonebook or FDN phonebook if it is activated using the CLCK command Data call without semicolon D2 Activates automatic DTR message transmission if DTR switches from OFF to ON Sends the short message in the first location of the SIM Note If the first location is empty e AT D1 and AT D2 commands will receive an OK response e The DTR ON event will trigger a CME ERROR 21 or a CMS ERROR 321 Syntax Command Syntax AT D lt n gt Command Possible responses AT D1 OK Note Activates DTR number dialing Note Command has been executed DTR is OFF
101. on modes 0 and 1 ADCValC ADC C value coded on 10 bits Displayed on mode 1 only ADCValD ADC D value coded on 10 bits Displayed on mode 1 only Command syntax AT ADC lt n gt Response syntax ADC lt ADCValA gt lt ADCVaIB gt lt ADCValC gt lt ADCVaID gt Command Possible responses AT ADC ADC 0 1 Note Ask for the list of possible values Note possible values 0 or 1 AT ADC 0 OK Note Select 2 converters mode 0 Note 2 converters mode selected AT ADC ADC 500 412 OK Note Ask for the current values of Note ADC A ADC B on 10 bits converters in mode 0 AT ADC 1 OK Note Select extended mode mode 1 Note Extended mode selected Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 111 Chapter 13 Specific AT Commands Mobile Equipment Event Reporting CMER This command enables or disables sending of unsolicited result codes in the case of a key press Description Values Syntax lt keyp gt keypad 0 1 2 No keypad event reporting Keypad event reportings are routed using unsolicited code CKEV key press only those key pressings which are not caused by CKPD are indicated Keypad event reportings are routed using unsolicited code CKEV key press all key pressings are indicated Note As AT software does not manage the emulation of key press the values 1 and 2 lead to the same results
102. parameters AT CGMM Command Possible responses AT CGMM MULTIBAND 900E 1800 Note Get hardware version OK Note Multiband GSM 900 MHz extended band and DCS 1800 default configuration AT CGMM 900E Note Get hardware version OK Note 900 Extended AT CGMM 1800 Note Get hardware version OK Note DCS AT CGMM 1900 Note Get hardware version OK Note PCS AT CGMM G850 Note Get hardware version OK Note GSM 850 AT CGMM Note Get hardware version MULTIBAND G850 1900 OK Note Multiband GSM 850 and PCS Request Revision Identification CGMR Description Values Syntax Displays the revised software version No parameters AT CGMR Command Possible responses AT CGMR 657_09gg Q2406B 2015268 100506 17 01 Note Get software version OK Note Software release 6 57 generated on the 5th of October 2006 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 13 Chapter 4 General AT Commands Product Serial Number i CGSN Description Values Syntax Allows the user application to get the IMEI Interrnational Mobile Equipment Identity 15 digit number of the product No parameters AT CGSN Command Possible responses AT CGSN 012345678901 234 OK Note Get the IMEI Note IMEI read from EEPROM AT CGSN CME ERROR 22 Note Get the IMEI Note IMEI not found in EEPROM Select TE Character Set
103. particular GSM 900 1800 or 1900 band Service Group Value Added Services Service External Value Restriction of menus options for manual PLMN selection 73 Restriction of menus options for Voice Mail or other similar menus 74 Restriction of menus options for the ability to send Short 75 Messages with type Paging Restriction of menus options for the ability to send Short 76 Messages with type Email Restriction of menus options for Fax calls 77 Restriction of menus options for Data calls 78 Restriction of menus allowing the user to change language 80 Service Group Information Numbers Service External Value The ME shall only present information numbers to the user if this 81 field is set to FF Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 186 Appendix B ME SIM Toolkit Support Appendix B ME SIM Toolkit Support TABLE 1 Support of SIM Toolkit classes This has been extracted from the GMS Technical Specification 11 14 Command description CALL CONTROL XX CELL BROADCAST DOWNLOAD XX DISPLAY TEXT XX EVENT DOWNLOAD gt gt S O MTeal ooo y Call connected ooo O ts j p Useracivity XY Idle screen available o 1 1 X X GETINPUT 5 y O XO GET READER STATUS MultipleCard PFE e MORE TIME o P X P X 9 Xx i PLAY TONE
104. required by user Data Contains the key pressed by the user Values when CmdType 3 Get Input Result 0 Session ended by user 1 Response given by the user 2 Help information required by user Data Contains the string of characters entered by the user Note For Inputs in UCS2 format the data are entered in ASCII format Example For 8000410042FFFF entered the SIM receives 0x00 0x41 0x00 0x42 with UCS2 DCS See the Appendix G about the different UCS2 syntaxes Values when CmdType 4 Setup call Result 0 User refuses the call 1 User accepts call Values when CmdType 6 Select Item Result 0 Session terminated by the user 1 Item selected by the user 2 Help information required by the user 3 Return to the back item Data Contains the item identifier selected by the user Values when CmdType 11 Setup Event List Result 1 Idle screen available 2 User activity event Sending a Terminal Response to the SIM Values when CmdType 95 Backward Move Values when CmdType 96 Command beyond ME capabilities Values when CmdType 97 ME currently unable to process command Values when CmdType 98 No response from the user Values when CmdType 99 SIM Toolkit Session aborting by the user No values It is possible to send a Terminal Response after the STIN indication step 2 of Messages exchanged during a SIM Toolkit operation or after the STGI command step 3 Note For the SETUP MENU Proacti
105. responses AT CMGF CMGF 1 OK Note Current message format Note Text mode AT CMGF CMGF 0 1 OK Note Possible message format Note Text or PDU modes are available Example Sending an SMS Message in PDU mode Command Possible responses AT CMGF 0 OK Note Set PDU mode Note PDU mode valid AT CMGS 14 lt CR gt CMGS 4 0001030691214365000004C9E9340B OK Note Send complete MSG in PDU mode no Note MSG correctly sent mr is returned SC address Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 64 Chapter 9 Short Messages Commands Save Settings CSAS Description All settings specified by the CSCA and CSMP commands are stored in EEPROM if the SIM card is a Phase 1 card or in the SIM card if it is a Phase 2 SIM card Values No parameters Syntax Command Syntax AT CSAS Command Possible responses AT CSAS OK Note Store CSCA and CSMP parameters Note Parameters saved Restore Settings CRES Description All settings specified in the CSCA and CSMP commands are restored from EEPROM if the SIM card is Phase 1 or from the SIM card if it is a Phase 2 SIM card Values No parameters Syntax Command Syntax AT CRES Command Possible responses AT CRES OK Note Restore CSCA and CSMP parameters Note Parameters restored Show Text Mode Parameters CSDH Description This command gives additional information about t
106. returns values supported as a compound value If the modem supports several PDP types PDP type the parameter value ranges for each PDP type are returned on a separate line The read command returns the current settings for each defined context The test command returns values supported as a compound value If the modem supports several PDP types PDP type the parameter value ranges for each PDP type are returned on a separate line Values cid PDP Context Identifier a numeric parameter 1 4 which specifies a particular PDP context definition The parameter is local to the DTE modem interface and is used in other PDP context related commands PDP type Packet Data Protocol type a string parameter which specifies the type of packet data protocol e IP Internet Protocol e PPP Point to Point Protocol lt APN gt Access Point Name a string parameter which is a logical name that is used to select the GGSN or the external packet data network If the value is null or omitted then the subscription value will be requested PDP address a string parameter that identifies the modem in the address space applicable to the PDP If the value is null or omitted then a value may be provided by the DTE during the PDP startup procedure or a dynamic address will be requested The read form of the command will continue to return the null string even if an address has been allocated during the PDP startup procedure The allocated
107. see Specification of Power Down Control via RS232 in the Appendix Values mode 0 Disable 32kHz powerdown mode 1 Enable 32kHz powerdown mode Syntax Command syntax AT W32K lt mode gt Command Possible responses AT W32K 1 OK Note Enable 32kHz power down mode Note 32kHz power down mode is enabled AT W32K 0 OK Note Disable 32kHz power down mode Note 32kHz power down mode is disabled Change Default Melody WCDM Description This command allows a the selection of a manufacturer specific melody This default melody will be played for any new incoming voice call either on the buzzer or on the speaker Values melody 0 No melody default 1 10 Melody 1 to 10 lt player gt 0 Melody n lt melody gt will be played on the buzzer for any new incoming voice call Default 1 Melody n lt melody gt will be played on the speaker for any new incoming voice call Syntax Command syntax AT WCDM lt melody gt lt player gt Command Possible responses AT WCDM 0 OK Note Select no melody AT WCDM 5 OK Note Select melody n 5 AT WCDM WCDM 5 0 Note Indicate the current melody OK Note Melody n is currently selected and the buzzer is selected to play it RING Note An incoming call occurs and the melody n is played on the buzzer AT WCDM 1 OK Note Select the speaker to play the melody on AT WCDM WCDM 5 1 OK Note Now the speaker is selected to play the melody if an in
108. to 1 INFORMATION NMR Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 188 Appendix C Structure of the Terminal Profile mis byte Event driven information b7 b6 b5 b4 b3 b2 bi Proactive SIM SET UP EVENT LIST Set by product to 1 Event MT call Set by product to 1 Event Call connected Set by product to 1 Event Call disconnected Event Location status Event User activity Event Idle screen available Event Card reader status Set by product to 1 Set by product to 1 User choice User choice Set by product to 0 Sixth byte reserved for Event driven information extensions b8 b7 b6 b5 b4 b3 b2 bi RFU bit 0 QUEE byte Multiple card proactive commands for class a b7 b6 b5 b4 b3 b2 bi Proactive SIM POWER ON CARD Set by product to 0 Proactive SIM POWER OFF CARD Set by product to 0 Proactive SIM PERFORM CARD APDU Set by product to 0 Proactive SIM GET READER STATUS Set by product to 0 RFU bit 0 Set by product to 0 Fd byte Proactive SIM b7 b6 b5 b4 b3 b2 bl Set by product to 1 Set by product to 1 Set by product to 0 Set by product to 0 Set by product to 0 Set by product to 0 Set by product to 0 Proactive SIM TIMER MANAGEMENT start stop Proactive SIM TIMER MANAGEMENT get current value Proactive SIM PROVIDE LOCAL INFORMATION date time and time zone Binary choice in GET INKEY SET UP IDLE MODE TEXT RUN AT COMMAND e g class b is supported 2nd
109. to 115200 D 08 04 05 Added Length of Phone Numbers section to Chapter 3 Changed maximum length of phone numbers to 60 digits Added mode to CMGF values Added new command CMMS Removed values 2 and 4 from N Increased I O ports to ten in the index value of WIOR and WIOW Added more text to WRIM Removed one note from CGCONT Changed the font size from 10 point to 9 point this brought the manual under 200 pages E 01 23 06 Added and to products listed on the cover F 05 10 07 Added the WMBS a command that supports quad band builds Updated the Technical Support contact list G 08 24 07 Updated the WIND command H 01 16 08 Updated the cover and MMCModem product name l 09 25 08 Updated the ECHO commands and removed Fax commands Removed all references to HR Half Rate Added four new Phonebook commands WCOS WPGW WPGR WPGS Added SMS Command WMCP Updated to version 6 57d Trademarks MultiModem SocketModem and the Multi Tech logo are registered trademarks of Multi Tech Systems Inc MMOCModenm is a trademark of Multi Tech Systems Inc Technical Support Country By Email By Phone Europe Middle East Africa support multitech co uk 44 118 959 7774 U S Canada all others support multitech com 800 972 2439 or 763 717 5863 World Headquarters Multi Tech Systems Inc 2205 Woodale Drive Mounds View Minnesota 55112 Phone 763 785 3500 or 800 328 9717 Fax 763 785 9874 Internet Address http
110. to instruct the SC to reject an SMS SUBMIT for an SM still held in the SC that has the same mr and da as the previously submitted SM from the same oa MTI Message Type Indicator b1 0 amp b0 0 gt SMS DELIVER in the direction SC to MS b1 0 amp b0 1 gt SMS SUBMIT in the direction MS to SC In text mode vp is only coded in relative format The default value is 167 24 hours This means that one byte can describe different values Validity period value 0 to 143 VP 1 x 5 minutes up to 12 hours 14410 167 12 hours VP 143 x 30 minutes 16810 196 VP 166 x 1 day 197 to 255 VP 192 x 1 week This is used to indicate the higher layer protocol being used or indicates interworking with a certain type of telematic device For example 0x22 is for group 3 telefax 0x24 is for voice telephone 0x25 is for ERMES European Radio Messaging System This is used to determine the way the information is encoded Compressed text is not supported Only GSM default alphabet 8 bit data and UCS2 alphabet are supported Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 72 Chapter 9 Short Messages Commands Syntax Command Syntax AT CSMP lt fo gt vp lt pid gt lt dcs gt Command Possible responses AT CSMP CSMP 0 0 0 0 OK Note current values Note No validity period lt dcs gt PCCP437 alphabet 8 bits gt 7 bits
111. use of user to user signalling 28 Service Group Teleservices Service External Value Short Message Mobile Terminated 33 Short Message Mobile Originated 34 Short Message Cell Broadcast 35 Restricts menu options for the ability to set reply path active on 36 outgoing Short Messages SMS Delivery Confirmation 37 Restriction of menus for SMS Protocol ID options 38 Validity Period restriction of menus for SMS Validity period options 39 Service Group CPHS Teleservices Service External Value Alternate Line Service 41 Service Group Number Identification Service External Value Calling Line Identification Presentation 57 Connected Line Identification Restriction 59 Connected Line Identification Presentation 60 Malicious Call Indicator 61 CLI per call mode default block CLI menu to send CLI 63 CLI per call mode default block CLI menu to block CLI 64 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 185 Appendix A Result Codes Failure Causes Other Tables Service Group Phase 2 Services Service External Value Menus concerned with GPRS functionality 65 Menus concerned with High Speed Circuit Switched Data 66 functionality ASCII Voice Group call menus 67 ASCII Voice Broadcast service menus 68 Multi Subscriber profile menus 69 Multi band Restriction of menus allowing user to select a 70
112. 0 3 0 1 512 2048 6 250 Note Test command OK AT DS 3 0 2048 250 OK Note Set new parameters Note Command valid AT DS DS 3 0 2048 20 Note Current values OK Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 97 Chapter 11 Data Commands V42bis Data Compression Report DR Description This command determines whether or not the use of V42bis is allowed for an incoming or outgoing data call if this feature is provided by the product The intermediate result code represents current DCE DCE data compression type The format of this result code is as follows DR NONE Data compression is not in use DR V42B Rec V 42 bis is in use in both directions DR V42B RD Rec V 42 bis is in use in receive direction only DR V42B TD Rec V 42 bis is in use in transmit direction only The DR intermediate result code if enabled is issued before the final result code before the ILRR intermediate report and after the service report control CR Values status State of the V42bis 0 Disable Default value 1 Enable Syntax Command syntax AT DR lt status gt Command Possible responses AT DR DR 0 1 Note Test command OK AT DR 1 OK Note Reporting enabled Note Command valid AT DR DR 1 Note Current value OK Note Command valid Select Data Error Correcting Mode N Description If this feature is provided by
113. 0 bauds once or twice or just AT at 9600 bauds to resynchronize the modem The DTE waits for 1ms after receiving the last character of the AT response which is always n or Ox0A to send a new AT command at either the same rate or a new rate Should this delay be ignored the DCE can become desynchronised Once again sending AT V once or twice or just AT causes the DCE to recover Caution When starting up if autobauding is enabled and no AT command has yet been received the product sends all unsolicited responses like RING at 9600 bauds Values value Baud rates that can be used by the DCE 0 Enables autobauding 300 600 1200 2400 4800 9600 19200 38400 57600 115200 Syntax Command syntax AT IPR lt value gt Command Possible responses AT IPR IPR 9600 OK Note Current rate is 9600 bps AT IPR IPR 0 2400 4800 9600 19200 38400 57600 115200 300 600 1200 OK Note Possible values according to V25ter Recommendation The first set of values indicates the range of auto detectable baud rates including 0 The second set of values indicates the baud rates supported by the DCE but not auto detectable AT IPR 38400 OK Note Disable autobauding and set rate to 38400 bps AT IPR 0 OK Note Enable autobauding Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 99 Chapter 12 V 24 and V 25 Commands DTE DCE Character Framing ICF
114. 2 kbit s 2 000 000 4 4 kbit s 5 000 000 11 1 kbit s 10 000 000 20 000 000 50 000 000 Best effort 22 kbit s 44 kbit s 111 kbit s Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 152 Chapter 15 GPRS Commands Syntax Command Syntax Possible Response s AT CGQREQ lt cid gt precedence gt OK lt delay gt lt reliability gt lt peak gt ERROR lt mean gt AT CGQREQ CGQREQ cid precedence gt delay lt reliability gt lt peak gt lt mean gt lt CR gt lt LF gt CGQREQ cid precedence gt delay reliability peak mean AT CGQREQ CGQREQ lt PDP_types list of supported precedence s list of supported delay s list of supported lt reliability gt s list of supported lt peak gt s list of supported mean s lt CR gt lt LF gt CGQREQ PDP types list of supported precedence s list of supported delay s list of supported lt reliability gt s list of supported lt peak gt s list of supported mean s AT CGQREQ 1 1 4 5 2 14 TOK AT CGQREQ CGQREG IP 1 3 1 4 1 5 CGQREQ PPP 1 3 1 4 OK OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 153 Chapter 15 GPRS Commands Quality of Service Profile Minimum Acceptable CG
115. 29 019876543210 129 fred mail_address com Becker Street London 1 Note Save the entry in the phonebook group 1 AT CPBW 13 331290909 145 Fred OK 0141284549 129 0600003210 129 0141280000 129 019876543210 129 fred mail_address com Becker Street London Note Save the entry in the phonebook without a group AT CPBW 13 331290909 145 Fred OK 0141284549 129 0600003210 129 0141280000 129 019876543210 129 fred mail_address com Becker Street London 0 Note Save the entry in the phonebook without a group This command is not allowed when the fixed dialing phonebook FDN is locked Moreover when the FDN is unlocked PIN2 is required to write in the FDN phonebook But if PIN2 authentication has been performed during the current session the CPBW command with FDN is allowed Command Possible responses AT CPBS FD OK Note Choose FDN AT4CPBWz5 01290917 129 Jacky CME ERROR 17 i Note SIM PIN2 is required Note Write in FDN at location 5 AT CPIN CPIN SIM PIN2 Note SIM PIN2 is required AT CPIN 5678 OK Note Enter SIM PIN2 AT4CPBWz5 01290917 129 Jacky OK i Note Writing in FDN is now allowed Note Write in FDN at location 5 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 51 Chapter 8 Phonebook Commands Find Phonebook Entries CPBF
116. 5 for Custom to GSM conversion table Notes e chari and lt char2 gt are not ASCII codes they stand for the range of a given character in the tables e f only char 1 is provided only this char is displayed edited e See Appendix C for informative examples of the use of these characters Command syntax AT WCCS lt mode gt lt table gt lt char 1 gt lt char 2 gt Command Possible responses AT WCCS 0 0 120 130 Note Display from character 120 to character 130 of the Custom to GSM conversion table WCCS 11 78797A2020202020097E05 OK Note 11 characters displayed AT WCCS 1 0 115 lt CR gt 20 lt ctrl Z gt Note Edit character 115 of the Custom to GSM conversion table OK Note Edition successful AT WCCS 1 1 0 4 lt CR gt 40A324A5E8 lt ctrl Z gt Note Edit the 5 first characters of the GSM to Custom conversion table OK Note Edition successful AT WCCS 0 2 20 lt CR gt Note Display character 20 of the Custom alphabet extension table WCCS 1 5E OK AT WCCS 1 1 200 Note Edit character 200 of GSM to Custom conversion table CME ERROR 3 Note Index out of range Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 124 Chapter 13 Specific AT Commands Lock WLCK Description This command allows the modem to be locked on a specific network operator Note Test SIM cards with MCC 001 amp MNC 01 doesn t check th
117. 592356897 OK 4 Note SIM lock activated Note Activate SIM lock AT WLCK PU 12345678 2081035 OK Note Activate Network Subset lock on SFR Note Network Subset lock activated 208 10 35 AT WLCK PU 12345678 20810 CME ERROR 3 Note Need 7 digits of IMSI to perform a service provider lock AT WLCK PP 12345678 20810 E5 OK Note Activate Service Provider lock on SFR Note Service Provider lock activated 208 10 and GID1 OxE5 AT WLCK PC 12345678 20810 E5 10 OK Note Activate Corporate lock on SFR 208 Note Corporate lock activated 10 GID1 0xE5 and GID2 0x10 AT WLCK PN 12345678 20810 0 OK Note Activate Network lock on SFR 208 10 Note Network lock activated on SFR and co using co operative network list from SIM file operative network list present in SIM EFCNL must be present in SIM AT WLCK PN 12345678 20801 1 02F802 OK FFFFFFO2F801FFFFFF Note Activate Network lock on FORANGE Note Network lock activated on F ORANGE 208 01 with manual co operative network primary network SFR and Bouygues Telecom list including SFR 208 10 and Bouygues co operative networks Telecom 208 20 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 125 Chapter 13 Specific AT Commands CPHS Command CPHS Description Values Syntax Examples AT CPHS AT CPHS 3 1 AT CPHS 1 1 This command
118. 6290800 lt CR gt Please call me soon Fred lt ctrl Z gt Note Send a message in text mode CMGS lt mr gt OK Note Successful transmission AT CMGS lt length gt lt CR gt gt Note Send a message in PDU mode 1 3 lt pdu gt Note Enter message in PDU mode 2 3 lt ctrl Z gt CMGS lt mr gt Note End the message 3 3 OK Note Successful transmission The message reference lt mr gt is returned to the application and allocated by the product This number begins with 0 is incremented by one for each outgoing message successes and failures and is cyclic on one byte 0 follows 255 Note This number is not a storage number Outgoing messages are not stored Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 70 Chapter 9 Short Messages Commands Write Message to Memory CMGW Description Values Syntax This command stores a message in memory either SMS SUBMIT or SMS DELIVERs The memory location lt index gt is returned no choice possible as with phonebooks CPBW Text or PDU is entered as described for the Send Message CMGS command lt oa da gt Originating or Destination Address Value in string format lt tooa toda gt Type of Originating Destination Address lt stat gt Integer type in PDU mode default 2 for CMGW or string type in text mode default STO UNSENT for CMGW Indicates the status of message in memory If stat i
119. 77 WVMI Unsolicited Result Voice Mail Indicator 128 4WYVR Voice Baleus cec et er rta ex e ER EN YR eV Feci ect a 119 3 32kHz Power Down Mode W32K 123 A A Answer a Gallio sc aardi 21 A Remote Disconnection sicui isses etie aes its 21 A Repeat last command nee 15 Abort Command 4MVAG essct 116 Accumulated Call Meter 4CAOCM seeess 85 Accumulated Call Meter Maximum CAMM 86 Advice of Charge CAOC ssseeeeee 85 Alarm Management CALA sse 18 Alternate Line Service WALS sssusssss 132 Analog Digital Converter Measurements ADC 111 Answer a Call A 21 Automatic Answer S ort rripet Trendi etia Sende 23 Automatic Dialing with DTR 96D 23 Automatic Response to Network Request for PDP Context Activation CGAUTO sssssseeeeee 164 Auto Tests amp T sssessssssssssseeeeeeeennnne 104 Avoid Phonebook Initialization WAIP 56 B Back to Online Mode O sse 102 Bearer Type Selection CBST ssessss 93 C Gall Baring OEGK iini ci casei uence 81 Gall Forwarding GG uiuo utum Eae tet e RSS PEE cedo enr dE 80 Call Related Supplementary Services CHLD 87 Call Waiting EG OMA iiun icenian 82 Calling Line Identification Presentation CLIP
120. 8 65 66 68 70 71 0 0 3 Note Test command OK Note Data 14 4 kbps not supported AT CBST CBST 0 8 12 14 65 66 68 70 71 75 0 0 3 OK Note Data 14 4 kbps not supported AT CBST 7 0 1 Note Ask for a bearer OK Note Bearer supported AT CBST Note Current values CBST 7 0 1 OK Note Command valid AT CBST 81 0 0 Note Ask for a bearer CME ERROR 4 Note Bearer not supported Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 93 Chapter 11 Data Commands Select Mode FCLASS Description This command puts the product into a particular operating mode data or fax Values n 0 Data Syntax Command syntax AT FCLASS n Command Possible responses AT FCLASS FCLASS 0 Note Test command OK Note Fax class 2 not supported AT FCLASS FCLASS 0 Note Test command OK AT FCLASS 0 OK Note Data mode requested Note Command valid OK Note Command valid AT FCLASS FCLASS OK Note Current value Note Command valid Service Reporting Control CR Description This command enables a more detailed type of service reporting in the case of incoming or outgoing data calls Before sending the CONNECT response to the application the product will specify the type of data connection that has been set up These report types are CR ASYNC For asynchronous transparent CR REL ASYNC For asynchronous non tran
121. AT CFUN 1 OK Note Reset the product AT ECHO ECHO 1 6 30 8000 256 Note Read current settings OK AT ECHO 0 OK Note Deactivate the Echo Cancellation AT ECHO 0 OK Note Deactivate the Echo Cancellation AT ECHO 1 6 30 50 256 200 CME ERROR 519 550 15 32767 27484 38697 7311 2 Note The new algorithm will be activated after a Note Activate the Echo Cancellation 6 reset of the product AT ECHO ECHO 6 30 50 256 200 550 15 32767 32767 Note Read the Echo Cancellation settings 27484 38697 7311 2 65535 OK AT CFUN 1 OK Note Reset the product AT ECHO ECHO 1 6 30 50 256 200 550 15 32767 32767 Note Read the Echo Cancellation settings 27484 38697 7311 2 65535 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 29 Chapter 5 Call Control Commands SideTone Modification SIDET Description This command sets the level of audio feedback in the speaker microphone feedback in the speaker Values lt val1 gt 0 SideTone is disabled 1 SideTone is enabled lt val2 gt default value 0 will be used if this parameter is not given 0 Odb 1 6db 2 12db 3 18db Syntax AT SIDET lt val1 gt lt val2 gt Command Possible responses AT SIDET 1 0 OK Note Command valid AT SIDET SIDET 1 0 Note Current value OK Note Command valid AT SIDET SIDET 0 1 0 3 OK Initialize Voice Parameters VIP Description This command allows factory settings for voice p
122. AT WPGR2 3 1 WPGR 1 433123456789 145 John WPGR 2 33567891234 145 Elvis WPGR 31 331290909 145 Fred WPGR 32 0123456789 129 Test OK Note SIM entries index 1 and 2 Flash entries index 31 and 32 The SIM supports 30 entries in this example Note List all extended entries of phonebook group 1 AT WCOS 1 OK Note Phonebook extended AT WPGR2 3 1 WPGR 1 33123456789 145 John 1 WPGR 2 33567891234 145 Elvis 1 WPGR 31 331290909 145 Fred 0141284549 129 060003210 129 0141280000 129 019876543210 129 fred 9 mail address com Becker Street London 1 WPGR 32 0123456789 129 Test 0141284549 129 70600003210 129 0141280000 129 6549873210 129 test o mail address com 1 OK Note SIM entries index 1 and 2 Flash entries index 31 and 32 The SIM supports 30 entries in this example Note The entries list displayed with AT WPGR 3 1 contains records from both the Mobile Equipment and the SIM phonebooks MT phonebook Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 58 Chapter 8 Phonebook Commands Settings of a Phonebook Group WPGS Description This commands sets the parameters of a phonebook group Values lt mode gt 0 Read group settings 1 Write group settings lt index gt Index of the group lt restrict call gt Parameter
123. COMNEN AE Meme Pm 194 Phonebook e UE CES ccc erae asc a a E Oe 194 cag Messages elita ced 194 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 7 Table of Contents Supplementary Gereieces COT be cessas aka kk ERR EK rae aien AA A Dena lado SEM ALERTE DE E SEP Vd uoo COMMONS isse p IP Ere E Dia EIo aus mg ann Ur MENU ENS IM ME RR REMO SION AT EDITOS S ERR ERO Garces cea VIS eed U DE tesa bonnedd b rad Rp eeauiieas EP M ERIS M MEA NEUE H MESE inb p Odin E Pa eb And Er IA OMNIS eet ee Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 Chapter 1 Introduction Chapter 1 Introduction Scope of This Document This document describes the AT command based messages exchanged between an application and the Multi Tech Systems Inc products in order to manage GSM related events or services Related Documents This interface specification is based on the following recommendations 1 ETSI GSM 07 05 Digital cellular telecommunications system Phase 2 Use of DTE DCE interface for Short Message Service SMS and Cell Broadcast Service CBS 2 ETSI GSM 07 07 Digital cellular telecommunications system Phase 2 AT command set for GSM Mobile Equipment ME 3 ITU T Recommendation V 25 ter Serial asynchronous automatic dialing and control 4 ETSI GSM 03 40 Digital cellular telecommunications system Phase 2 Technical implementation of the Short Message
124. CSCS Description Values Default Syntax Informs the modem which character set is used by the DTE The modem can convert each character of entered or displayed strings This is used to send read or write short messages See also WPCS for the phonebooks character sets lt Character Set gt GSM GSM default alphabet PCCP437 PC character set code page 437 CUSTOM User defined character set cf WCCS command HEX Hexadecimal mode No character set used the user can read or write hexadecimal values GSM alphabet AT CSCS lt Character Set gt Command Possible responses AT CSCS GSM OK Note GSM default alphabet Note Command valid AT CSCS PCCP437 OK Note PC character set code Note Command valid AT CSCS CSCS GSM PCCP437 CUSTOM HEX OK Note Get possible values Note Possible values Phonebook Character Set WPCS Description Values Syntax Informs the modem which character set is used by the DTE for the phonebooks The modem can convert each character of entered or displayed strings This is used to read or write phonebook entries See also CSCS for the short messages character sets lt Character Set gt TRANSPARENT Transparent mode The strings are displayed and entered as they are stored in SIM or in ME CUSTOM User defined character set cf WCCS command HEX Hexadecimal mode No character set used the user can read or write hexadecimal val
125. D AT CGREP WIND AT CGREG WIND AT CGAUTO WIND AT CGANS WIND AT CGADDR WIND AT WGPRS WIND None N Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 197 Index Index 75 C Select Data Compression ssssessss 97 D Automatic Dialing with DTR sisii 23 amp aoc Set DCD Sigiall c cssccssesceccisessteeatientae cnieecies 101 ab SEUDT ASG Mall descen d media pru dads 102 amp F Restore Factory Settings esessss 104 amp S Set DSR SONA ai cete esee ese EDU tesa cuin 102 GT AUO TBSIS iicet eril peees or Fa S HERR Ld Ri SCAN 104 amp V Display Configuration eeeeeeenee 105 amp W Save Gonfigutration e oreet retiro tet d nhe 103 T ADC Analog Digital Converter Measurements 111 CACM Accumulated Call Meter esssss 85 CALA Alarm Management eseseeeeeese 18 CAMM Accumulated Call Meter Maximum 86 CAOC Advice of Charge sse CBST Bearer Type Selection CCED Cell Environment Description 107 GCFC Call Forwarding e ccec trei recte cete eti erae ctc 80 s OGID Card IdentifiIGallon urit tbe re tette etin 15 CCLK Clock Management 18 CCUG Closed User Group 91 SOOWA Call Waits met ideo tte winners 82 CEER Extended Error Report 21 167 CFUN Se
126. D 3 Note Size updated according to the nearest flash sector sub division product reset in order to set the new A amp D storage place size AT WOPENS 6 WOPEN 6 960 640 OK Note 960 Kbytes are served for the A amp D storage place and 640 for the Open AT application AT WOPEN 5 CME ERROR 3 Note The Open AT Application is not running AT WOPEN 1 OK Note Start the embedded WIND 3 application Note Product reset in order to start the embedded application WOPEN 5 OK Note Suspend Open AT tasks AT WOPEN WOPEN 5 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 134 Chapter 13 Specific AT Commands Reset WRST Description This command resets the modem after the time specified by the delay parameter Values lt val1 gt 0 timer reset is disabled 1 timer reset is enabled lt Delay gt specify the time for reset Range 000 00 168 59 format hhh mm lt RemainTime gt time before next reset Range 000 01 168 59 format hhh mm Syntax Command syntax AT WRST lt Mode gt lt Delay gt Response syntax WRST lt Mode gt lt Delay gt lt RemainTime gt Command Possible responses AT WRST OK AT WRST 0 OK Note Disable timer AT WRST 1 001 03 OK Note Enable timer and put delay at 1 hour 3 minutes AT WRST WRST 1 001 03 001 01 OK Note Timer activated to reset after 1 hour and 3 minutes At this point 1 hour and 1 mi
127. D 3 N N AT CMEE WIND 3 N N AT CKPD Depends of the sequence used Y N N AT CCLK WIND 3 Y N AT CALA WIND 3 N Y AT CRMP WIND 3 N N AT CRSL WIND 3 N N AT CMUX N N Call Control Commands AT commands Conditions SIM dependence Intermediate ATD Depends of sequence used Y N Y ATH WIND 3 N N ATA WIND 3 N N AT CEER WIND 4 Y N AT VTD WIND 3 N N AT VTS WIND 5 N N ATDL WIND 3 N Y AT D WIND 3 N N ATSO WIND 3 N N AT CICB WIND 3 N N AT CSNS WIND 3 N N AT VGR WIND 3 N N AT VGT WIND 3 N N AT CMUT WIND 5 N N AT SPEAKER WIND 3 N N AT ECHO WIND 3 N N AT SIDET WIND 3 N N AT VIP WIND 3 N N Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 193 Appendix G Conditions for Command Execution and SIM Dependence Network Service Commands AT commands Conditions SIM dependence Intermediate AT CSQ WIND 3 N N AT COPS WIND 4 Y N AT CREG WIND 3 N Y AT WOPN WIND 3 N N AT CPLS PIN Y N AT CPOL After PIN entered Y Y AT COPN After PIN entered N N Security Commands AT commands Conditions SIM dependence __ Intermediate AT CPIN WIND 1 Y N AT CPIN2 after PIN entered Y N AT CPINC WIND 1 Y N AT CLCK WIND 4 Y N AT CPWD WIND 4 Y N Phonebook Commands AT commands Conditions SIM dependence Intermediate
128. D settings are automatically stored in non volatile memory EEPROM This means the amp W command does not need to be used and the selected flows are always activated after boot e Default value is 0 no flow activated no indication e AT WIND gives the possible value range 0 4095 e The unsolicited response will then be WIND event lt idx gt lt idx gt Call identifier defined in CLCC command e Or for event 10 WIND lt event gt lt phonebook gt lt status gt lt phonebook gt lt status gt e Or for event 11 WIND lt event gt lt checksum of SM gt lt checksum of FD gt lt checksum of ON gt lt checksum of SN gt lt checksum of EN gt lt checksum of LD gt e Or for event 15 NITZ indication WIND lt event gt 1 Full name gt 2 lt Short name gt 3 lt Local time zone gt 4 lt Universal time and local time zone gt 5 lt LSA identity gt 6 lt Daylight Saving Time gt Analog Digital Converter Measurements ADC Description Values Syntax This command gets the DC level 1024 of ADC A and ADC B and possibly ADC C These voltages are coded on 10 bits lt n gt 0 Select 2 converters 1 Select 3 converters lt ADCValA gt ADC A value coded on 10 bits The value returned includes the resistor bridge Values are updated every 10 seconds Displayed on modes 0 and 1 lt ADCVaIB gt ADC B value coded on 10 bits Displayed
129. E 98 Chapter 12 V 24 and V 25 COMMAS snes a A E 1v Ca gag RU na 41K SE UII 99 go oEPIUSIIDI AR Dg c 99 DTE DGCE Character Framing fesso cuir a IoHaTS FID ENE FEURR RH M IFNRYOH A REIP EISE 100 Pipccu wc3amecclNds c Heri MEI Is 101 tgp ECL RTT TTL UT T TEER AEE ET 101 S W EM Wg gece i MED EEA reer EE T UU ETT 102 SEL DESEE SE rto x a EXEERR E UI HAERRZIT ERIS VEXREUELEA NU E ORES IOAN E Terr mtr reer er tert rere re ator 102 ES ewes si cals ca E A EA TA rerrerreer caret A etree rrrer yt EA trrct ttre et 102 Result Coge Suppression ETOILE 102 HES Response Fornal Vaier E asta pi o E N 103 Deraut EIA A aiieieo ae E E 103 Sae Rer rDpE MR 103 nol Ip WE Ife em 104 er Mec A 104 Flesiore Faubn Sells AP uassieeraqdeituverer n dade qx p vEDR MER reti dae RD ARE UN Nd NS 104 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 5 Table of Contents Dispp DODENUS ne E E renee EEE NE reer saree fer rrseree pKAM E T erect rey ete tr 105 Ress IAS OMCATOM MORMON M cL 105 Ves eae Mode MILA cp EE 106 Chapter 19 SS OCU AT roi n 107 Cell Environment Desorption GOCE nsciis aa 107 Gonera reci esc AAND saca Em 109 Analog Digital Converter Measurements ADG csciscaiccaccisecsiesscsrecaccsrsncassssancc
130. E character set CSCS ss 14 Select Cell Broadcast Message Types CSCB 74 Set phone functionality CFUN ssuussssse 16 Select Message Service CSMS sss 61 Commands GPRS Send Message 4 CMGS sss 70 Automatic Response to Network Request for PDP Send Message From Storage CMSS 72 Context Activation x CGAUTO seseess 164 Service Center Address CSCA sesss 74 Cellular Result Codes CRC ssss 166 Set Text Mode Parameters CSMP 72 Define PDP Context CGDCONT 149 Show Text Mode Parameters CSDH 65 Enter Data State CGDATA sese 157 Write Message to Memory CMQW 71 Extended Error Report CEER 167 Commands SIM ToolKit GPRS Attach or Detach CGATT sss 155 SIM ToolKit Get Information STGI cece 143 GPRS Event Reporting 4 CGEREP 160 SIM ToolKit Give Response STGR 146 GPRS Mobile Station Class CGCLASS 158 SIM ToolKit Indication STIN or STRIL 142 GPRS Network Registration Status CGREG 161 SIM ToolKit Set Facilities STSF 140 GPRS Parameters Customization WGP
131. Failure Cause from GSM 04 08 Recommendation 4CEER sese nnne nennen enne 176 Spacie Falus Caso 10k AGEE R cnaid ia ika E 177 GSM 04 11 Annex E 2 Mobile Originating SM Transfer esssessesessseeeeeeenneen nennen nnns 178 Unsolicited Resul COSE oor cotra cet a ated lon EUER Pa UR Fd demise mend E EE E dE 179 Fast Resuli CodeS i soo ebur dA E hid RV urea e eU Ed M BE duni C E 179 intermediate ROSU Odo ENTE C 0 LL LL 0L LS 179 Gud ier SiO AOS MOG Meme 180 c Ee re L1G M HH 182 iui asnnieizi t M 184 Cop CTS E secs ee Pe ee oe Ee NM MEM MM A eee eee eee ne eee 185 Appendix B ME SIM Toolkit SUpport ccccceeeeeeseeeeeeeeeeeeeeeeeeeneeeeeeaaeeseeeseeeseseneeesaseeeeseseeeseseeeeesassoneeeeseenaeeeneanens 187 Appendix C Structure of the Terminal Profile eeeesseeeeeeeeee eene nennen nnne nnne nennen arret 188 Appendix D Command Type and Next Action Indicator eeeesesssisesssesseeeeeeennenne nennen nnne nnne 190 Appendix E Coding of Alpha fields in the SIM for UCS2 ccccccceceseeeseeeeee cece eee eeeeeeeeee eee seaeeeseeeseseeneeeeeeeeeees 191 Appendix F Command Execution and Dependence on SIM 2 cccccessssseeeeeeeeeeeeeeeeeeeeeeseneenaeeeeeseseseeeeeneeeeeees 193 e TATA Nea IE EO I C DDR mS 193 Gall Control Commande e 193 Network Serie C mmMmand Mn 194 SONY
132. GPRS AT Commands Document Number S0002931 79 Chapter 10 Supplementary Services Commands Chapter 10 Supplementary Services Commands Call Forwarding CCFC Description This commands allows control of the call forwarding supplementary service Values reason 0 Unconditional 1 Mobile busy 2 No reply 3 Not reachable 4 Allcall forwarding 5 All conditional call forwarding lt mode gt 0 Disable 1 Enable 2 Interrogate 3 Registration 4 Erasure type TON NPI Type of address byte in integer format default 145 when dialing string includes international access code character otherwise 129 class 1 Voice 2 Data 3 Fax 4 Short Messages 5 Allclasses Note The combination of different classes is not supported it will only result in the activation deactivation status request of all classes 7 In the case where the FDN phonebook is activated the registration is restricted to the phone numbers written in the FDN If Class parameter is not given in the command 7 is used as the default value lt subaddr gt not managed lt satype gt not managed lt time gt For lt reason gt 2 No reply 4 all call forwarding and 5 all conditional call forwarding time to wait 1 to 30 in seconds before call is forwarded Default value is 20 lt status gt 0 not active 1 active Syntax Command syntax AT CCFC lt reason gt lt mode gt lt number gt lt type gt
133. ISDNS for different Description Values Syntax services each MSISDN is returned in a separate line lt alphax gt optional alphanumeric string associated with lt numberx gt lt numberx gt string type phone number with format as specified by lt typex gt lt typex gt Command syntax AT CNUM type of address byte in integer format Response syntax CNUM lt alpha1 gt lt number1 gt lt type1 gt lt CR gt lt LF gt CNUM lt alpha2 gt lt number2 gt lt type2 gt Command Possible responses AT CNUM Note Get MSISDN s OK CNUM Phone 0612345678 129 CNUM Fax 0687654321 129 CNUM 80001002FFFF 40183773 145 UCS2 format Note MSISDNs AT CNUM OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 Chapter 8 Phonebook Commands Avoid Phonebook Initialization WAIP Description This specific command allows the initialization of all phonebooks to be inhibited during subsequent boots Values lt mode gt 0 Normal initialization with phonebooks 1 No phonebook initialization Syntax Command Syntax AT WAIP lt mode gt Command Possible responses AT WAIP WAIP 0 OK Note Current values Note Default value init phonebooks AT WAIP WAIP 0 1 Note Possible values OK Note Disable enable AT WAIP 1 OK Note Inhibit initialization of phonebooks next boot
134. K Set GPIO 0 as an input and all others as outputs AT WIOM 128 OK Set GPIO 3 default output value to 1 AT WIOM 128 OK Note Set GPIO 8 or GPIO12 or GPIO7 default output value to 1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 115 Chapter 13 Specific AT Commands Abort Command WAC Description This command allows SMS SS and PLMN selection related commands to be aborted Values No parameters Syntax Command syntax AT WAC Command Syntax Return AT WAC AT WAC OK AT WAC OK Example 1 Command Possible responses AT COPS Note Available PLMN AT WAC OK Note Abort the request of PLMN list Note PLMN list request aborted Example 2 Command Possible responses AT CCFC 0 2 Note Query status of Call Forwarding service AT WAC Note Abort the request of the query of the Call Forwarding service CME ERROR 551 Note Query of Call Forwarding service request failed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 116 Chapter 13 Specific AT Commands Play Tone WTONE Description Values Syntax This command allows a tone to be played on the current speaker or on the buzzer Frequency gain and duration can be set mode 0 Stop playing 1 Play atone dest Sets the destination mandatory if mode 1 1 Speaker 2 Buzzer fr
135. Label gt lt Help Info gt lt NextActionld gt lt CR gt lt LF gt STGI lt Id2 gt lt Nbltems gt lt Alpha Id2 Label gt lt Help Info gt lt NextActionld gt lt CR gt lt LF gt SIM expects an item choice STGR pro active command No action Refresh done automatically by product pro active command No action Send SS done automatically by product pro active command No action Send SMS done automatically by product 10 Get information about Send USSD STGI lt Textinfo gt pro active command No action Send USSD done automatically by product 11 Get information about SETUP EVENT LIST STGI lt Evt gt pro active command Values for the SIM Toolkit Get Information Command Values when CmdType 0 Setup menu lt Alpha Idenitifer menu gt Alpha identifier of the main menu lt Idx gt 1 255 Menu item Identifier lt Nblitems gt 1 255 Number of items in the main menu lt Alpha Idx Label gt Alpha identifier label of items in ASCII format lt HelpInfo gt 0 No help information available 1 Help information available lt NextActionld gt Contains a pro active command identifier see the table in APPENDIX F Compared to other commands the customer application can always get information about setup menu after having received the STIN 0 indication Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 143 Chapter 14 SIM Toolkit Values when Cm
136. Location 8 is written The string has a wrong UCS2 format It is therefore considered as an ASCII string AT CPBW 5 01290917 129 Jacky Note write an extended entry CME ERROR 3 Note Error because WCOS 0 AT WCOS 1 OK Note Phonebook extended AT CPBW 5 01290917 129 Jacky 1 OK Note Write an extended entry AT WCOS 0 OK Note Phonebook not extended AT4CPBS ME OK Note ME Phonebook AT CPBS CPBS ME 2 500 Note How many entries are used Note in ME phonebook 2 locations are used and 500 locations are available AT4CPBWZ 1 0123456798 129 first entry Note Write a not extended entry OK AT CPBW 1 0123456798 129 first entry 9876543210 129 Note Write an extended entry CME ERROR 3 Note Error because WCOS 0 AT CPBR 1 CPBR 1 0123456798 129 first entry Note Read the first entry AT WCOS 1 OK Note Phonebook extended AT4CPBWZ 1 0123456798 129 first entry OK Note Write an entry not extended AT CPBW 2 9876543210 129 second OK entry 6543210987 129 Note Write an extended entry AT CPBR 1 2 Note Read entry 1 and 2 CPBR 1 0123456798 129 first entry AT CPBW 13 331290909 145 Fred 0141284549 129 0600003210 129 0141280000 129 019876543210 129 fred mail_address com Becker Street London 1 Note Write location with Contact and Phonebook Group n1
137. Mobile Equipment phonebook with AT WCOS 1 lt CR gt lt LF gt CPBN lt loc gt lt num gt lt type gt lt name gt lt Contact gt lt Phb_group gt Command Possible responses AT CPBN CPBN 0 5 Note Test command OK Note Possible modes AT CPBS SM OK Note ADN phonebook AT WCOS 0 OK Note Phonebook not extended AT CPBN 0 CPBN 15 331290101 145 Eric Note Read the first location OK Note Display the first location AT WCOS 1 OK Note Phonebook extended AT CPBN 2 CPBN 5 33147658987 145 Frank 0 Note Read the next location OK Note Display the second location extended entry AT CPBN 2 CPBN 6 331290302 145 Marc 0 Note Read the next location OK Note Display the third location extended entry AT WCOS 0 OK Note Phonebook not extended AT CPBN 3 CPBN 5 4 33147658987 145 Frank Note Read the previous location OK Note Display the second location AT CPBN 1 CPBN 6 331290302 145 Marc Note Read the last location OK Note Display the last location AT CPBN 2 CPBP 15 4 331290101 145 Eric Note Read the next location OK Note Display the first location Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 54 Chapter 8 Phonebook Commands Using mode 4 and 5 with CPBF command and CPBW Command Possible responses AT CPBF Er Note Find Er in phonebook CPBF 15 4331290101 145 Eri
138. OK Note Location 13 is written AT4CPBWS 433145221100 145 SOS Note Write at the first location available OK Note First location available is written AT CPBW2 0345221100 145 SOS Note Write at the first location available CME ERROR 20 Note Phonebook full AT CPBW 57 112 129 WM Note Write at location 57 wrong CME ERROR 21 Note Invalid index AT CPBW57 012345678901 234567890 129 WAVE Note Write at location 7 a phone number exceeding the limit 21 digits CME ERROR 26 Note Phone number too long AT CPBW57 0122334455 129 WAVECOMTEL Note Write at location 7 along text 11 characters CME ERROR 24 Note Text too long AT CPBS SM OK Note ADN phonebook AT WCOS WCOS 1 OK Note Extended phonebook AT CPBR 1 CPBR 1 0123456 129 test OK AT4CPBWZz1 0123456 test 1 OK Note Add an extended entry in SIM with group number 1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 50 Chapter 8 Phonebook Commands CPBW Command Table Continued Command Possible responses AT CPBR 1 CPBR 1 0123456 129 test OK AT CPBW 1 0123456 test 1 OK Note Add an extended entry in SIM with group number 1 AT CPBR 1 CPBR 1 0123456 129 test 1 OK AT CPBW 13 331290909 145 Fred OK 0141284549 129 0600003210 129 0141280000 1
139. OLP After PIN entered Y N AT CAOC After PIN entered Y Y AT CACM After PIN entered Y N AT CAMM After PIN entered Y N AT CPUC After PIN entered Y N AT CHLD WIND 5 2 Y N AT CLCC WIND 3 N N AT CSSN WIND 3 N N AT CUSD WIND 3 N N AT CCUG WIND 4 Y Y Data Commands AT commands Conditions SIM dependence Intermediate AT CBST WIND 3 N N AT FCLASS WIND 3 N N AT CR WIND 3 N N AT CRC WIND 3 N N AT ILRR After PIN entered N N AT CRLP WIND 3 N N AT DOPT WIND 3 N N AT C WIND 3 N N AT DS WIND 3 N N AT DR WIND 3 N N N WIND 3 N N V24 V25 Commands AT commands Conditions SIM dependence __ Intermediate AT IPR WIND 3 N N AT ICF WIND 3 N N AT IFC WIND 3 N N AT amp C WIND 3 N N AT amp D WIND 3 N N AT amp S WIND 3 N N ATO CLCC X 0 0 1 X N N data call ATQ WIND 3 N N ATV WIND 3 N N ATZ WIND 3 N N AT amp W WIND 3 N N AT amp T WIND 3 N N ATE WIND 3 N N AT amp F WIND 3 N N AT amp V WIND 3 N N ATI WIND 3 N N AT WMUX WIND 3 N N Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S000293l Appendix G Conditions for Command Execution and SIM Dependence Specific AT Commands AT commands Conditions SIM depende
140. OMIN Description Values Syntax This command allows the DTE to specify a minimum acceptable profile which is checked by the modem against the negotiated profile returned in the Activate PDP Context Accept message The set command specifies a profile for the context identified by the local context identification parameter cid Since this is the same parameter that is used in the CGDCONT command the CGQMIN command is effectively an extension to the CGDCONT command The QoS profile consists of a number of parameters each of which may be set to a separate value A special form of the set command CGQMIN cid causes the minimum acceptable profile for context number cid to become undefined In this case no check is made against the negotiated profile The read command returns the current settings1 for each defined context The test command returns values supported as a compound value If the modem supports several PDP types the parameter value ranges for each PDP type are returned on a separate line cid a numeric parameter which specifies a particular PDP context precedence a numeric parameter which specifies the precedence class delay a numeric parameter which specifies the delay class reliability a numeric parameter which specifies the reliability class peak a numeric parameter which specifies the peak throughput class mean a numeric parameter which specifies the mean throughput class
141. P internet 0 0 CGCONT 2 IP abc com 0 0 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 150 Chapter 15 GPRS Commands Quality Description Values of Service Profile Requested CGOREO This command allows the DTE to specify a Quality of Service Profile that is used when the modem sends an Activate PDP Context Request message to the network The set command specifies a profile for the context identified by the local context identification parameter cid Since this is the same parameter that is used in the xCGDCONT command the CGQREQ command is effectively an extension to the CGDCONT command The QoS profile consists of a number of parameters each of which may be set to a separate value A special form of the set command CGQREQ cid causes the requested profile for context number cid to become undefined The read command returns the current settings for each defined context The test command returns values supported as a compound value If the modem supports several PDP types the parameter value ranges for each PDP type are returned on a separate line cid Numeric parameter that specifies a particular PDP context definition Range 1 3 precedence Numeric parameter that specifies the precedence class 0 Subscribed precedence Subscribed by the Network by default if value is omitted 1 High priority Service commitments shall be ma
142. Possible values Al 4 IR 4 AB 4 AG 4 AC 4 P2 8 FD 8 PN 8 PU 8 PP 8 PC 8 OK Note CHV1 CHV2 must be on 8 digits maximum 4minimum For call barring on 4 digits maximum AT CPWD SC 1234 5555 OK Note Change PIN Note PIN was correct AT CPWD SC 1234 5555 CME ERROR 16 Note Change PIN Note PIN was wrong AT CPIN 5555 OK Note Enter PIN Note PIN was correct AT CPWD PN 12345678 00000000 OK Note Change NCK Note NCK changed for net lock Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 44 Chapter 8 Phonebook Commands Chapter 8 Phonebook Commands Introduction to Phonebook Commands A phonebook group can hold up to 100 entries These entries can come from different phonebooks SIM and or Flash phonebook When a SIM is inserted the phonebook selected by default is set by the command CPBS About the Parameters SIM Contact Structure lt num_Home gt Home phone number lt Name gt Name Extended SIM Contact Structure lt num_Home gt Home phone number lt Name gt Name lt Phb_Group gt Phonebook group This structure can be used to write and read contacts in mode extended WCOS 1 and with ADN phonebook selected CPBS SM Extended Contact Structure lt num_Home gt Home phone number lt Name gt Name lt num_Mobile gt Mobile phone number lt num_Work gt Work phone nu
143. RG 168 Unsolicited Result SIM ToolKit Control Response Manual Response to Network Request for PDP Context ae Si Pa met 146 Activation GGAN Sei misrap ei 165 Commands Specific PDP Context Activate or Deactivate CGACT 156 32kHz Power Down Mode W32K 123 Quality of Service Profile Minimum Acceptable Abort Command 4WAC ssseseee 116 FC GOMIN me 154 Alternate Line Service WALS sssse 132 Quality of Service Profile Requested CGQREQ 151 Analog Digital Converter Measurements ADC Tii Request GPRS IP Service D 162 Cell Environment Description 4CCED 107 Select Service for MO SMS Messages CGSMS 159 Change Default Melody WCDM 129 Service Reporting Control CR sssse 167 Change Default Player WCDP ssss 130 Show PDP Address CGPADDR ss 166 CPHs Command OPHS ucc certe cte ien 126 Commands Network Service CPHSiInionmation WOP eninin ei 129 Network Registration CREQG ssessssss 33 CPHS Mail Box Number WMBN 131 Operator List Management WOLM 33 Custom Character Sset WCCS suss 124 Operator Selection COPS eseussssss 31 Customer Service Profile WCSP
144. ROR 545 is raised on the UART where AT CMUX command is trying to be started again Emergency call is not allowed without SIM COPS Emergency call is allowed without SIM COPS No flash objects to delete WOPEN The phone number of the requested phonebook entry is empt ATD gt lt index gt A1T D gt lt phonebook gt lt index gt Unable to resize the Application amp Data storage place since the WOPEN new required size would overlap with the current Open AT application storage place Service abort request has failed AT WAC Unsolicited responses for autodiag or charge indication are WDIAG WBCM already activated on another port Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 175 Appendix A Result Codes Failure Causes Other Tables Failure Cause from GSM 04 08 Recommendation CEER Unassigned unallocated number 6 Chamelunacepabe Cd 16 17 18 19 21 22 26 27 28 Invalid number format incomplete number 29 30 31 34 38 5 42 43 44 47 49 50 55 57 58 63 65 70 79 81 87 88 91 95 100 101 102 111 127 224 225 226 227 228 229 230 231 232 233 Continued on next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 176 Appendix A Result Codes Failure Causes Other Tables Continued Failure Cause from GSM 04 08 Recommendation CEER Specific Failure Cause for CEER 252 253 Call barr
145. Rel gt lt PcmThMax gt For Algold 6 AT ECHO lt modes gt lt Algold gt lt AlgoParam gt lt NoiseThres gt lt NmbTaps gt lt ConvergenceTime 1 gt lt ConvergenceTime2 gt lt NoiseLevelMAX gt lt DetectionThreshold gt lt CNGAdjust gt lt CNGPara m1 gt lt CNGParam2 gt lt CNGGain gt lt NmbDelay gt Response Syntax For Algold 1 ECHO lt status gt lt Algold gt lt VolOut gt lt Step gt lt PcmThRel gt lt PcmThMax gt For Algold 6 ECHO lt status gt lt Algold gt lt AlgoParam gt lt NoiseThres gt lt NmbTaps gt lt ConvergenceTime1 gt lt ConvergenceTime2 gt lt NoiseLevelMAX gt lt DetectionThreshold gt lt CNGAdjust gt lt CNGParam1 gt lt CNGParam2 gt lt CNGGain gt lt NmbDelay gt lt NoiseEstimate gt Command Possible responses AT CMEE 1 OK Note Enables the use of result code AT SPEAKER SPEAKER 0 OK Note Speaker ONE and Micro ONE are active AT SIDET 0 OK Note Deactivate the Sidetone AT SIDET SIDET 0 0 AT ECHO ECHO 0 1 0 6 10 7 Note Read current settings OK AT ECHO 1 1 0 6 10 7 OK Note Active Echo cancellation 1 for Mic Spk one AT ECHO ECHO 1 1 0 3 10 7 Note Read current settings OK AT ECHO 1 6 30 8000 256 CME ERROR 519 Note Activate the Echo cancellation 6 Note The new algorithm will be activated after a reset of the product AT ECHO ECHO 6 30 8000 256 Note Read the Echo cancellation settings OK
146. S CGCLASS CC OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 158 Chapter 15 GPRS Commands Select Service for MO SMS Messages CGSMS Description Values Syntax The set command specifies the service or service preference that the modem will use to send MO SMS messages The read command returns the currently selected service or service preference The test command requests information on the currently available services and service preferences lt service gt a numeric parameter which indicates the service or service preference to be used 0 GPRS 1 Circuit switched 2 GPRS preferred use circuit switched if GPRS is not available 3 Circuit switched preferred use GPRS if circuit switched not available Other values are reserved and will result in an ERROR response to the set command Command Syntax Possible Responses AT CGSMS lt service gt OK ERROR At CGSMS CGSMS service OK AT CGSMS CGSMS list of currently available lt service gt s OK AT CGSMS 0 AT CGSMS CGSMS 0 3 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 159 Chapter 15 GPRS Commands GPRS Event Reporting CGEREP Description Values Syntax Set command enables or disables sending of unsolicited result codes CGEV XXX from modem to DTE in the case of certain events occurring in the GPRS modem or the network
147. SC BS or The Service codes SC are 002 alicallforwarding 004 all conditional call forwarding 21 call forwarding unconditional 61 callforwardingonnoanswer 62 call forwarding on not reachable The Network service codes BS are 10 Allteleservices 11 Telephony o 142 Alidatateleservices _ 13 Faxservices _ 16 Short Message Services 147 Voice Group Call Service 18 Voice Broadcast Service 19 Allteleservices exceptSMS_ 20 21 22 240 25 26 _ 27 Note The no reply condition timer T is only used for SC 002 004 or 61 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 182 Appendix A Result Codes Failure Causes Other Tables Call Barring Note SC values are listed below BS values are covered in Call Forwarding SC Password Activate SC Password BS or SC Check status SC BS or SC Password BS or 03 330 OLDPWD NEWPWD NEWPWD Change password for call barring 03 OLDPWD NEWPWD NEWPWD or 03 330 OLDPWD NEWPWD NEWPWD or 03 OLDPWD NEWPWD NEWPWD or The Service codes SC are 33 call barring of outgoing call O 330 all barring service only for deactivation 331 call barring of outgoing international call 332 callbarring of outgoing international calls except to
148. Save Configuration amp W sse 103 Ser DCD Signal XO io itio AANA 101 Set DSR Sighial RS iir Storie she ner tci git 102 Set DTR Signal D ii cieieiee tetigerit enti 102 Connected Line Identification Presentation COLP 84 Contact Selector 4WGQOS tesis etate bdo sente 57 Copy Messages WMCP sese 78 CPHS Command GBEIS iniecta tote i tob e bec 126 GPHS Intotiatlon WOPL iiiter tete 129 GPHS Information Eleld iioii ciet 184 CPHS Mail Box Number WMBN eee 131 Create and Delete a Phonebook Group WPQW 57 CRES Restore SetllhtjS eres cre ettet Dp ao 65 CSP Cornstalilo ici rela eiet Let ed rud Le EE ESL s 185 Custom Character Set 4WOCCS ssssssess 124 Customer Service Profile WCSP 130 Customer Storage Mirror WMIR sssss 130 D Dial omina ueioiiieeteeeek ci esee c e Eee tene Pe Era po dordeuE 19 D Request GPRS IP Service sssss 162 Data ate V DEL cc ccisccsetzescactesatis tac nerd He ro stu oe deo su eius 120 DCE Response Format V see 103 Detault Configutalloh esc rettet terrenus 103 Define PDP Context CGDCONT seseeees 149 Delete Calls Phonebook WDOCP ssss 56 Delete Message CMGD eene 73 Dial Command Dos disais beue ieu eaea 19 Display Configuration
149. Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 127 Chapter 13 Specific AT Commands Unsolicited Result Voice Mail Indicator WVMI Description Values Syntax This unsolicited indication gives the status of the LINE 1 LINE 2 or Data mailbox The CPHS command can be used to know the status of the voice mail indicator for each line lt Lineld gt 1 Line1 2 Line2 3 Data lt Status gt 0 No message waiting 1 Atleast one message is waiting Command Syntax WVMl lt Lineld gt lt Status gt Response Syntax to AT CPHS 2 1 WVMI lt Lineld gt lt Status gt Command Possible responses AT CPHS 1 1 OK Note Activate Voice Mail Indicator feature AT CPHS 2 1 WVMI 1 1 a message is waiting on Line 1 Note Get the current status of Voice Mail WVMI 2 1 a message is waiting on Line 2 Indicator WVMI 3 0 no data waiting AT CPHS 2 1 CME ERROR 3 Note CPHS feature is not allowed AT CPHS 1 1 OK Note Activatation of Voice Mail Indicator feature Note Voice Mail Indicator feature is activated WVMI 1 1 Note A message is waiting on Line 1 Unsolicited Result Diverted Call Indicator WDCI Description Values Syntax This unsolicited indication provides the call forwarding flags The CPHS command can be used to know the status of the Divert Call Indicator for each line lt Lineld gt 1 Line1 2 Line2 3 Data lt flag gt status 0 Call f
150. This cause is used to report an invalid message event only when no other unspecified cause in the invalid message class applies 96 Invalid mandatory The equipment sending this cause has received a message where a mandatory information information element is missing and or has a content error the two cases are undistinguishable 97 Message type non The equipment sending this cause has received a message with a message existent or not type it does not recognize either because this is a message not defined or implemented defined but not implemented by the equipment sending this cause 98 Message not compatible The equipment sending this cause has received a message such that the with short message procedures do not indicate that this is a permissible message to receive while in protocol state the short message transfer state 99 Information element non The equipment sending this cause has received a message which includes existent or not unrecognized information elements because the information element identifier is implemented not defined or it is defined but not implemented by the equipment sending the cause However the information element is not required to be present in the message so that the equipment sends the cause to process the message 111 Protocol error This cause is used to report a protocol error event only when no other cause unspecified applies 127 Interworking unspecified There has been interworking with a network which
151. This command is used to display the modem configuration lt n gt 0 Displays the modem configuration in RAM Default value if no parameter provided 1 Displays the modem configuration in EEPROM 2 Displays the modem factory configuration Command syntax AT amp V lt n gt The parameters displayed are the following Q val 1 V val 2 SO val 3 S2 val 4 S3 val 5 S4 val 6 S5 val 7 CR val 8 CRC val 9 CMEE val 10 CBST val 11 SPEAKER val 12 ECHO val 13 amp C val 14 amp D val 15 C val 16 IPR val 17 ICF val 18 IFC val 19 Command Possible responses AT amp V Q 0 V 1 S0 000 82 043 83 013 84 010 85 008 Note Display active CR 0 CRC 0 CMEE 0 CBST 0 0 1 parameters in RAM SPEAKER 0 ECHO 0 0 amp C 1 amp D 2 C 0 IPR 9600 ICF 3 4 IFC 2 2 OK Note Done For Echo the first value corresponds to Echo cancellation 1 Request Identification Information I Description Values Syntax This command causes the product to transmit one or more lines of specific information text lt n gt Displays manufacturer followed by model identification Equivalent to CGMI and CGMM Displays revision identification Equivalent to CGMR Displays modem configuration in RAM Equivalent to amp VO Displays modem configuration in EEPROM Equivalent to amp V1 Displays modem data features Lists the supported data rates data modes and fax classes Displays modem voice features Other v
152. WPGW s lt index gt lt name gt Command Possible responses AT WPGW WPGW 1 10 30 Note Test command OK Note 10 possible groups group name can be 30 characters maximum Note Delete group 1 AT WPGWZ 1 group 1 OK Note Create group 1 Note Group 1 created AT WPGW 1 phb group 1 OK Note Rename group 1 Note Group 1 created AT WPGW 1 OK Note Group 1 deleted Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 57 Chapter 8 Phonebook Commands Read a Phonebook Group WPGR Description Values Syntax This commands reads the phonebook group entries the phonebook group name or the number or used records in a group lt mode gt 1 Read the name of one phonebook group 2 Read the names of all phonebook groups 3 List all entries of one phonebook group 4 Read the number of used records in a phonebook group lt index gt Index of the group for use with mode 3 or mode 4 Command Syntax AT WPGR lt mode gt lt index gt Command Possible responses AT WPGR Note Test command WPGR 1 4 1 10 OK Note 10 possible groups AT WPGR 1 1 Note Read the name of phonebook group 1 WPGR 1 group 1 OK AT WPGR 2 Note Read the name of all phonebook groups WPGR 1 group 1 WPGR 2 group 2 Note List all entries of phonebook group 1 OK AT WCOS 0 OK Note Phonebook not extended
153. WUSS command allows the SMS Status to be kept at UNREAD after the CMGR or CMGL commands are used Values lt mode gt 0 The SMS Status will change 1 The SMS Status will not change Syntax Command Syntax AT WUSS lt mode gt Command Possible responses AT WUSS WUSS 0 1 OK AT WUSS 1 OK CMTI SM 10 Note SMS has been received in index 10 AT CMGR 10 CMGR REC UNREAD 433660669023 03 02 13 18 36 35400 CR LF Do you want to change state OK AT CMGR 10 CMGR REC UNREAD 33660669023 03 02 13 18 36 35 00 lt CR gt lt LF gt Do you want to change state OK Note The state hasn t been updated AT WUSS 0 OK CMTI SM 11 Note SMS has been received in index 11 AT CMGR 11 CMGR REC UNREAD 433660669023 03 02 13 18 56 55400 CR LF It is me again OK AT CMGR 11 CMGR REC UNREAD 33660669023 03 02 13 18 56 55 00 lt CR gt lt LF gt It is me again OK Note The state has been updated AT WUSS WUSS 0 OK AT CMGR 10 CMGR REC READ 33660669023 03 02 13 18 56 55400 CR LF It is me again OK Note The state has been updated AT WUSS WUSS 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 77 Chapter 9 Short Messages Commands Copy Messages WMCP This command copies the SMS from the SIM to the Flash or from the Flash to t
154. Wireless GSM GPRS Modems MultiModem GPRS wrcBa o MMCModem M GPRS MTMMC G SocketModem GPRS urswc o AT Commands Reference Guide Multi lech Systems Copyright and Technical Support AT Commands for Wireless GSM GPRS Modems Reference Guide These Commands Apply to the Following Products MultiModem GPRS MTCBA G MultiModem GPRS USB MTCBA G U MultiModem GPRS with Ethernet Interface MTCBA G EN MMCModem GPRS MTMMC G SocketModem GPRS MTSMC G PN S000293l Revision Copyright This publication may not be reproduced in whole or in part without prior expressed written permission from Multi Tech Systems Inc All rights reserved Copyright 2003 2008 by Multi Tech Systems Inc Multi Tech Systems Inc makes no representations or warranties with respect to the contents hereof and specifically disclaims any implied warranties of merchantability or fitness for any particular purpose Furthermore Multi Tech Systems Inc reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of Multi Tech Systems Inc to notify any person or organization of such revisions or changes Revisions Revision Level Date Description A 07 15 03 Initial release B 03 08 04 Added Values to each command Added new commands C 09 28 04 Changed data fax call to ATD lt nb gt and voice call to ATD lt nb gt Changed Autobauding is supported operating from 2400
155. ab source code The recorded sequence shall be made in the noisy conditions and contain noise only The allowed range is 0 65535 The default for CNGParam1 is 27484 The default for CNGParam2 is 38697 e lt CNGGain gt 16 bits comfort noise AR2 gain coefficients This specifies the gain of the AR2 filter used for comfort noise generation It will be estimated by the same tools use to estimate CNGParam1 and CNGParam2 It is represented as a Q15 of 16 bits The allowed range is 0 32767 The default is 7311 lt SOMValue gt Switch attenuation value at the beginning of the call This parameter will range from 1 to 16 and set the depth of the attenuation of the transmit audio signal when speech is detected on the distant side The default is 4 lt NoiseEstimate gt Value of the noise floor estimate written by the DSP only in case of active communication The allowed range is 0 32 when a communication is active Otherwise the returned value is 65535 Notes e The field NoiseEstimate is present only for Algold 6 and only in the response to AT ECHO e When anew algoid is selected AT ECHO returns 3 for the mode The changes will be taken into account after a reset Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 28 Chapter 5 Call Control Commands Syntax Command Syntax For Algold 1 AT ECHO lt mode gt lt Algold gt lt VolOut gt lt Step gt lt PcmTh
156. acmnontsncstanvdeestacesaesiatersetiianctianneeaats 111 Mobile Equipment Event Reporting OM uisi senes rroen EE UY 3 UE EEU E HER eines nae EX FPRP ET MEE ERIS 112 Read Language Preterence WLP Fis a ascen ie sivanssasiventvacess nndir eaae a EEEa aia 113 Write Language PTR EMI WY Pee 113 Eos GFO VANO WOR einan aair naii a 114 Morte GPIO Yale SOUS roiie iieiaei aeaii a A AUD a ka EK dr Ani 114 liput Output Management WIOM Pee 115 Apat SMV TWA tbt EE 116 PRY TONE VPN m 117 PRY DIMF TONS Le TIE oorsake aa irean ee a a ai aE EEE OEE 118 Bess IM WDY ER 118 Voice Rale WYR e 119 Data Rate VDA M 120 Selci voe Gahi ANSV anrea EEA 121 reaa A E a s oO A E E A A IE A E E rere vite terre eter ere 121 E ame a e a N t TRENT C TI TT 122 Uma epe ie dues Massil H 122 xr d ra Re i r me 122 Change Beta lt Melody Eleg pe Lv M Rm 123 custom EELCIT ICE Elias po cciacensscatcitidecuscidntas Sicgatiacenaatinn Adduaceeta ENNES Nee aa ia 124 Loek SIDA qe Es 125 GPHSCGommand eOPES iacob TAE EE Eana 126 Unsolicited Result Voice Mall Indicator VV VM iui ieri cess rre ex rre Rx FIw ER FER a S Fi Para aaa 128 Unsolicited Result Diverted Call Indicator MDGL ciriciri 128 Network Operator Name XIBIDN wiiren ere redisse eX YAN IX
157. again so that it is detected Background Initialization After entering the PIN Personal Identification Number some SIM user data files are loaded into the product Phonebooks SMS status etc Please be aware that it might take some time to read a large phonebook The AT CPIN command response comes just after the PIN is checked After this response user data is loaded in background This means that some data may not be available just after PIN entry is confirmed by OK The reading of phonebooks will then be refused by CME ERROR 515 or CMS ERROR 515 meaning Please wait service is not available init in progress This type of answer may be sent by the product at several points e When trying to execute another AT command before the previous one is completed before response e When switching from ADN to FDN or FDN to ADN and trying to read the relevant phonebook immediately e When asking for CPIN status immediately after SIM insertion and before the product has determined if the inserted card is a valid SIM Card About the Length of Phone Numbers Phone numbers can consist of up to 60 digits The first 20 digits are stored in the SIM in the phonebook file EFaon EFron or EF np corresponding to the selected phonebook The next digits are stored in other extension SIM files EFgxr or EFextz Example Number of Digits Nb of Records in EFapn Nb of Records in EFexri 1 to 20 1 0 21 to 40 1 1 41
158. ails automatic mode is entered format format format of oper field 0 long alphanumeric format oper 1 short alphanumeric format oper 2 numeric oper default value stat Status of operator 0 unknown 1 available 2 current 3 forbidden Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 31 Chapter 6 Network Service Commands oper Operator identifier MCC MNC in numeric format only for operator selection The long alphanumeric format can be up to 16 characters long see Codes and Values Appendix for operator names description field is Name The short alphanumeric format can be up to 8 characters long Syntax To force an attempt to select and register on a network the application must send this command Command Syntax AT COPS lt modes lt format gt oper Possible Responses for AT COPS lt mode gt Possible Responses Meaning OK Network is selected with full service CME ERROR 30 No network service CME ERROR 32 Network not allowed emergency calls only CME ERROR 3 Not allowed during communication CME ERROR 4 Incorrect parameters CME ERROR 527 Please wait and retry your selection later CME ERROR 528 Location update failure emergency calls only CME ERROR 529 Selection failure emergency calls only CME ERROR 546 Emergency call is not allowed without SIM CME ERROR 547 Emergency
159. all Forward Activated Indicator for Line 2 14 13 Call Forward Activated Indicator for Data 15 14 Call Forward Activated Indicator for Fax 16 15 Reserved 17 16 Reserved 18 17 Reserved 19 18 Reserved 20 19 Line 1 Mailbox Number Available 21 20 Line 2 Mailbox Number Available 22 21 Date Mailbox Number Available 23 22 EF Mn Updatable 25 24 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 184 Appendix A Result Codes Failure Causes Other Tables CSP Constants Service Group Call Offering Service External Value Call Forwarding Unconditional 1 Call Forwarding on User Busy 2 Call Forwarding on No Rely 3 Call Forwarding on User Not Reachable 4 Call Transfer 5 Service Group Call Restriction Service External Value Barring of All Outgoing Calls 9 Barring of Outgoing International Calls 10 Barring of Outgoing International Calls except those directed to 11 the Home PLMN country Barring of All Outgoing Calls 12 BIC Roam 13 Service Group Other Supplementary Services Service External Value Multi Party Service 17 Closed User Group 18 Advice of Charge 19 Perferential CUG 20 CUG Outgoing Access 21 Service Group Group Completion Service External Value Call Hold 25 Call Waiting 26 Completion of Call to Busy Subscriber 27 Restriction of the menus allowing
160. alpha identifier in SET UP CALL 2nd capability configuration Set by product to 0 parameter see 9 1 6 pus byte b7 b6 b5 b4 b3 b2 bli Sustained DISPLAY TEXT see 6 4 1 SEND DTMF command see 6 4 24 RFU bit 0 RFU bit 0 RFU bit 0 RFU bit 0 RFU bit 0 RFU bit 0 Subsequent bytes b8 b7 b6 Set by product to 0 Set by product to 0 b5 b4 b3 b2 bi RFU bit 0 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 189 Appendix D Command Type and Next Action Indicator Appendix D Command Type and Next Action Indicator This table has been extracted from the GMS Technical Specification 11 14 Used for Next ing seeing a C 02 MORETIME CX O 09 POLLINTERVAL X O 04 POLLINGOFF X 05 SETUPEVENTLIST O X y i SENDDIMF X O 26 PROVIDELOCALINFORMATION X 27 TIMERMANAGEMEN X X X 30 PERFORM CARD APDU _ class a only 30 POWER ON CARD class a only POWER OFF CARD class a only GET READER STATUS class a only RUN AT COMMAND class b only X End of the proactive session not applicable Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 190 Appendix E Coding of Alpha Fields in the SIM for UCS2 Appendix E Coding of Alpha fields i
161. alues OK string will be sent back NOR oc Command syntax ATl n Command Possible responses ATIO WAVECOM MODEM Note Manufacturer and model 900P identifications OK Note GSM 900 MHz primary band ATI3 657 099g Q2406B 2015268 100506 17 01 Note Revision identification OK Note Software release 6 57 generated on the 5th of October 2006 ATI6 DATA RATES Note Modem data features AUTOBAUD 300 1200 1200 75 2400 4800 9600 14400 DATA MODES T NT ASYNCHRONOUS OK Note Done ATI7 SPEECH CODINGS FR EFR HR AMR Note Modem voice features OK Note Done Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 105 Chapter 12 V 24 and V 25 Commands Multiplexing Mode WMUX Description This command manages the data AT commands in multiplexing mode See Appendix B for the Data Commands multiplexing protocol description Values lt mode gt 0 Multiplexing disabled When the product is online data communication in progress no AT command can be used default 1 Multiplexing enabled Data flows and AT commands are multiplexed while in online mode data communication in progress Note The Mulitplexing mode is available to only one UART If this mode is available on UART1 and the AT WMUX 1 command is sent through UART2 the multiplexing mode will be available on UART2 and disabled on UART1 Syntax Command syntax AT WMUX lt mode gt Command Possible responses
162. alues are listed after the Command Table Syntax Command syntax STGl lt CmdType gt Command Possible responses AT STGl lt CmdType gt CME ERROR lt err gt AT STGI STGI 0 11 OK Table of Command Types Cmd Description Possible responses Type 0 Get information about Setup Menu STGI lt Alpha Identifier menu gt pro active command STGI lt Ild1 gt lt Nbltems gt lt Alpha Id1 Label gt lt Help Info gt lt NextActionld gt lt CR gt lt LF gt STGI lt Id2 gt lt Nbltems gt lt Alpha Id2 Label gt lt Help Info gt lt NextActionld gt lt CR gt lt LF gt No action expected from SIM 1 STGI lt Prior gt lt Text gt lt ClearMode gt pro active command No action expected from SIM 2 STGI lt Format gt lt HelpInfo gt lt TextInfo gt pro active command SIM expects key pressed STGR 3 Get information about Get Input STGI lt Format gt lt EchoMode gt lt SizeMin gt lt SizeMax gt pro active command lt HelpInfo gt lt Textinfo gt SIM expects key input STGR 4 STGI lt Type gt lt CalledNb gt lt SubAddress gt lt Class gt pro active command SIM expects user authorization STGR 5 STGI lt ToneType gt lt TimeUnit gt lt Timelnterval gt lt TextInfo gt pro active command No action 6 Get information about Sel Item STGI lt Defaultltem gt Alpha Identifier menu gt lt CR gt lt LF gt pro active command STGI lt Ild1 gt lt Nbltems gt lt Alpha Id1
163. ame Service feature lt lac gt is an optional parameter to read names from OPL PNN sim files If it is not entered name will be given with current lt lac gt Note that in limited service current lt lac gt is set to 0 It also allows the erasing of NITZ PLMN names stored in the flash memory by using AT WOPN 3 0 When the modem receives a NITZ Network Information and Time Zone message with Long Name or Short Name information an entry with registered PLMN and names in the message is created in the flash memory These names will then be used with COPS COPN WOPN and CPOL with the priority order defined in 3GPP TS 22 101 The modem supports only network names with the GSM default alphabet coding schemes The user can choose which of the following methods will be used for getting PLMN names using the command AT WOPN 4 lt PlimnOns gt The priority order is First entry if on Home PLMN or matching entry if existing in OPL PNN SIM files If on Home PLMN use SIM file CPHS ONS 0x6F 14 for Long Name if present and SIM file CPHS SONS 0x6F 18 for Short Name if present if not present reuse SIM file If there is a matching entry in the list of names received so far use it Note that in France for example all the operators use the NITZ message for the Date and Time feature but not for PLMN names so the list is always empty In France the NITZ If there is a matching entry in the flash PLMN list created by WOLM use i
164. arameters to be restored from EEPROM These voice parameters include e Gain control VGR amp VGT commands e Gain controller WSVG command e Microphone mute control CMUT command e Speaker amp Microphone selection SPEAKER command e Echo cancellation ECHO command e Side tone modification SIDET command Values lt n gt 1 Restore all voice parameters Other values are not supported Syntax AT VIP lt n gt Command Possible responses AT VIP VIP 1 OK AT VIP 2 CME ERROR 3 Note Syntax error AT VIP 1 OK Note Restore the factory settings from EEPROM Note The command has been executed AT VIP 1 CME ERROR 519 Note Restore the factory settings from EEPROM Note Reset the product to accept the new with the current Echo cancellation algorithm algorithm different of the default algorithm AT VIP VIP 1 Note List of supported lt n gt s OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 30 Chapter 6 Network Service Commands Chapter 6 Network Service Commands Signal Quality CSQ Description This command determines the received signal strength indication lt rssi gt and the channel bit error rate lt ber gt with or without a SIM card inserted Values lt rssi gt 0 113 dBm or less 1 111 dBm 2to30 109to 53 dBm 31 51dBm or greater 99 not known or not detectable lt ber gt 0 7 as RXQUAL values in t
165. ate network serving the remote user international network 10 network beyond interworking point Note In order to have a Normal Release use the ATH command Noh WD Syntax Command Syntax AT WATH lt RelCause gt lt location gt Command Possible responses AT WATH 31 OK Note Ask for disconnection with release Note All calls if any are released cause normal and location USER AT WATH WATH 1 127 0 5 7 10 AT WATH 17 2 OK Note Ask for disconnection with release Note All calls if any are released cause user busy and location public network serving the local user Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 136 Chapter 13 Specific AT Commands Multi Band Selection WMBS Description Values Syntax Use this command to select the GSM bands on which the modem will work This command is allowed only if the selected bands are supported You can choose whether the change is immediate or not e Either the modem has to be reset to take this change into account this is the default e or the GSM stack restarts immediately on the specified band s In this mode the command WMBS is forbidden during the initialization phase of the modem and during calls lt Band gt 0 oOuhwohnd lt Param gt 0 1 Note frequency band configuration to be supported mono band mode 850 MHz mono band mode 900 MHz mono band mode 1800 MHz mono band m
166. ault 1 Suppress OA 2 Suppress preferential CUG 3 Suppress OA and preferential CUG Note To activate the control of the CUG information by call add G or g to the ATD command Index and info values will be used Command syntax AT CCUG n lt index gt info Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 91 Chapter 11 Data Commands Chapter 11 Data Commands Using AT Commands During a Data Connection To use AT Commands during a data connection such as while the product is in online mode it is necessary either to switch to offline mode or to use the WMUX command to enable Commands Data multiplexing Switch from Online to Offline Mode To switch from online mode to offline mode the sequence must be sent Following this the product gets back to offline mode with an OK response and an AT command can be sent Note The sequence only works with the ICF command using the following settings e 8 data bits with no parity e 7 data bits with even parity Switch from Offline to Online Mode See the ATO command description Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 92 Chapter 11 Data Commands Bearer Type Selection CBST Description This command applies to both outgoing and incoming data calls but in a different way For an outgoing call the two parameters e g speed and lt ce gt
167. ault Note Controller 2 selected AT WSVG WSVG 0 1 Note Get the list of possible values Note possible values 0 or 1 AT WSVG WSVG 1 Note Get the current value Note Controller 1 is selected Status Request WSTR Description This command returns some operation status It can be used to check the state of the initialization sequence the different values returned are Not started Ongoing Finished Values lt status gt 1 Initialization sequence value 0 Not started 1 On going 2 Finished Network status value 0 No network 1 Network available 2 Syntax Command syntax AT WSTR lt status gt Response syntax WSTR lt status gt lt value gt Command Possible responses AT WSTR lt status gt WSTRi lt status gt lt value gt AT WSTR 1 WSTR 1 2 Note Select the status 1 INIT SEQUENCE OK Note Init finished AT WSTR 2 WSTR 2 1 Note Select the status 2 NETWORK STATUS OK Note The network is available AT WSTR WSTR 1 2 Note Ask the list of possible values Note possible values 1 2 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 121 Chapter 13 Specific AT Commands Scan WSCAN Description This command displays the received signal strength indication lt rssi gt for a specified frequency in absolute format This command is not allowed during communication Values absolute frequency freque
168. ax AT CLIR lt n gt Response syntax CLIR lt n gt lt m gt for AT CLIR Command Possible responses AT CLIR 2 OK Note Command valid AT CLIR CLIR lt n gt lt m gt Note Ask for current functionality OK Note lt n gt and lt m gt as defined above Calling Line Identification Presentation CLIP Description Values Syntax This command controls the calling line identification presentation supplementary service When presentation of the CLI Calling Line Identification is enabled and calling subscriber allows CLIP response is returned after every RING or CRING result code lt n gt Parameter sets shows the result code presentation in the TA 0 Disable 1 Enable lt m gt parameter shows the subscriber CLIP service status in the network 0 CLIP not provisioned 1 CLIP provisioned 2 Unknown no network Command syntax AT CLIP lt n gt Response syntax CLIP lt n gt lt m gt as response to AT CLIP CLIP numbers lt type gt lt subaddr gt lt satype gt alpha for an incoming call after each RING or CRING indication Command Possible responses AT CLIP 1 OK Note Enable CLIP Note CLIP is enabled AT CLIP CLIP lt n gt lt m gt Note Ask for current functionality OK Note lt n gt and lt m gt defined as below RING Note Incoming call CLIP 0146290800 129 1 F RED Note Incoming call with number and name presentation
169. ay lt ctrl Z gt OK Note Successful transmission CDS 2 116 33146290800 145 98 10 01 12 30 07 04 98 10 01 12 30 08 04 0 Note message was correctly delivered Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 67 Chapter 9 Short Messages Commands Read Message CMGR Description Syntax Notes Syntax This command allows the application to read stored messages The messages are read from the memory selected by the xCPMS command AT CMGR lt index gt Command syntax Response syntax for text mode For SMS DELIVER only CMGR lt stat gt lt oa gt lt alpha gt lt scts gt lt tooa gt lt fo gt lt pid gt lt dcs gt lt sca gt lt tosca gt lt length gt lt CR gt lt LF gt data For SMS SUBMIT only CMGR lt stat gt lt da gt lt alpha gt toda fo pid dcs vp sca lt tosca gt lt length gt lt CR gt lt LF gt data For SMS STATUS REPORT only CMGR lt stat gt lt fo gt lt mr gt lt ra gt lt tora gt lt scts gt lt dt gt lt st gt Response syntax for PDU mode CMGR lt stat gt lt alpha gt lt length gt lt CR gt lt LF gt lt pdu gt A message read with status REC UNREAD will be updated in memory with the status REC READ The stat parameter for the SMS Status Reports is always READ Command Syntax AT CMGR lt index g
170. bit 9 SIM phonebooks reload status 1024 bit 10 SIM phonebooks checksum indication 2048 bit 11 Interruption indication only if FTR INT is activated 4096 bit 12 Hardware rack open closed indication 8192 bit 13 NITZ indication 16384 bit 14 SMS service ready indication Combination addition of the values is used to allow more than one indication flow 0 lt IndLevel lt 32767 event 0 1 2 3 cA 10 11 12 13 e To activate a specific WIND indication lt IndLevel gt must have a value described above AT WIND 16384 only activates SMS service indication e To activate several WIND indications lt IndLevel gt must have a value just before the last indication required AT WIND 32767 all unsolicited indications The SIM presence pin has been detected as SIM removed The SIM presence pin has been detected as SIM inserted Calling party is alerting Product is ready to process AT commands except phonebooks AOC SMS at init or after AT CFUN 1 Product is ready to process all AT commands end of phonebook init or swap FDN to ADN Call lt idx gt has been created after ATD or CCWA Call lt idx gt has been released after a NO CARRIER a CSSU 5 indication or after the release of a call waiting The network service is available for an emergency call The network is lost Audio ON Show reload status of each SIM phonebook after init phase after Power ON or SIM insertion Show
171. c OK Note Display the location AT CPBN 2 Note Read the next location CPBN 5 33147658987 145 Frank OK Note Display the following location AT CPBF Er Note Find Er in phonebook CPBF 15 331290101 145 Eric OK Note Display the location AT CPBN 4 CPBF 15 331290101 145 Eric Note Get the last location read OK Note Display the last location read AT CPBW 0146290800 129 WM OK Note Write an item at the first location available Note No information about this location AT CPBN 4 Note Get the last location read CPBF 15 331290101 145 Eric OK Note Display the last location read AT CPBN 5 Note Display the last item written with its location AT4CPBN 38 0146290800 129 WM Note Display the last item written with its location AT CPBN 4 Note Get the last item read AT CPBN 38 0146290800 129 WM Note Now the last item read is the last written item too AT CPBF 800041 FFFF Note Find 800041 in phonebook CPBF 15 3312345 145 8000414339FFFF OK Note Display this location AT CPBN 4 Note Get the last location read CPBF 15 43312345 145 8000414339FFFF OK Note Display the last location read Note The AT CPBN 5 command is useful after an AT CPBW command is used without a location Subscriber Number CNUM This command returns the subscriber MSISDN s If the subscriber has different MS
172. c format for lt oper gt oper characterstring or integer see lt format gt indicating operator identifier lt GSM_AcT gt GSM access technology lt GSMcomp_Act gt GSM compact access technology lt Utran_Act gt UTRA access technology 0 access technology not selected 1 access technology selected AT CPOL index lt format gt lt oper gt lt GSM_AcT gt lt GSMcomp_Act gt lt Utran_Act gt The different possibilities are AT CPOL lt index gt to delete an entry AT CPOL format to set the format used by the read command AT CPOL AT CPOL lt format gt lt oper gt to put lt oper gt in the next free location AT CPOL index format oper to write oper in the format at the index AT CPOL indexs format oper GSM AcT GSMoep Act Utran Act To write oper in the format at the index precising the access technology in the case of EF PLMNwact EF HPLMNwact or EF OPLMNwact is present Note Per default if Acces technology parameters are not given the GSM access technology will be chosen The supported format are those of the COPS command The length of this list is limited to 85 entries for EF PLMNsel and 51 for EF PLMNwAcCt EF OPLMNwAct EF HPLMNwAct See table on next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 37 Chapter 6 Network Service Commands Command Possible responses
173. ces List 183 GSM Security Sequences List ssss 182 GSM Sequences List iiic eres ea tto es ti ioeiese 182 H A Rang Up command iet metes 20 Hang Up EVA TI sp au iiis seco iot er retos e cb ke ai 136 Hang Up command Tli etti akt nette Re eode 20 I Request Identification Information 105 Incoming Call Bearer CICB seseessess 24 Information responses result codes 10 IMA Z AMON IHE 11 Initialize Voice Parameters VIP ooo eeeeeeeeneeeeeeneees 30 Input Output Management WIOM 115 K Keypad control CKPD sse 17 L IEg E M E 10 List Current Calls amp CLOOC sssee 88 List Message CMGL eeisrra tr aa 69 Lock WCK Gum H 125 M Manual Response to Network Request for PDP Context Activation OGDANS 2i ctesit recte at rers de etes dece inert 165 Manufacturer identification CGMI 13 ME Mobile EGUIPIMOMME ciii srinata 9 ME SIM ToolKit Supportrar aisiais 187 Message Overwriting WMGO sesseeess 76 Message Status Modification WMSC 75 Microphone Mute Control CMUT sses 26 Mobile Equipment ME itr ettet 9 Mobile Equipment Event Reporting CMER 112 Mobile Originated Call MOC
174. cid a numeric parameter which specifies a particular PDP context definition Command Syntax AT CGANS Possible response s AT CGANS lt response gt OK lt cid gt ERROR AT CGANS CGANS list of supported lt responsess list of supported lt L2P gt s OK CRING GPRS IP 122 41 74 238 AT CGANS 1 CONNECT AT CGANS CGANS 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 165 Chapter 15 GPRS Commands Show PDP Address CGPADDR Description Values Syntax Example The execution command returns a list of PDP addresses for the specified context identifiers The test command returns a list of defined lt cid gt s lt cid gt A numeric parameter which specifies a particular PDP context definition If no lt cid gt is specified the addresses for all defined contexts are returned lt PDP_address gt A string that identifies the modem in the address space applicable to the PDP The address may be static or dynamic For a static address it will be the one set by the CGDCONT command when the context was defined For a dynamic address it will be the one assigned during the last PDP context activation that used the context definition referred to by lt cid gt lt PDP_address gt is omitted if none is available Command Syntax AT CGPADDR Possible response s AT CGPADDR lt cid gt cid CGPADDR lt cid gt lt PDP_addr gt
175. cid gt is not supported or is supported but omitted the modem attempt to activate the context using the Empty PDP type GSM 04 08 No PDP address or APN is sent in this case and only one PDP context subscription record is present in the HLR for this subscriber Note If a GPRS PPP session is already running the setting of a CSD GSM data call is not supported lt GPRS_SC_IP gt GPRS Service Code for IP a digit string value 99 which identifies a request to use the GPRS with IP PDP types IP and PPP lt cid gt A digit string which specifies a particular PDP context definition Command Syntax Possible Responses D lt GPRS_SC_IP gt lt cid gt CONNECT ERROR ATD 99 1 CONNECT ATD 99 2 ERROR Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 162 Chapter 15 GPRS Commands Network Requested PDP Context Activation In this mode of operation the modem behaves like an answering modem and accepts the normal V 25ter commands associated with answering a call If GPRS specific configuration commands are required they may be sent to the modem as part of the modem initialization commands The CGAUTO command is used to select modem compatibility mode Automatic Response to a Network Request for PDP Context Activation SO The V 25ter SO n Automatic answer command may be used to turn off n 0 and on n gt 0 the automatic response to a network request for a PDP context activation Whe
176. coming call occurs Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 123 Chapter 13 Specific AT Commands Custom Character Set Description Values Syntax WCCS This command allows you to edit and display the custom character set tables These tables are used by the CUSTOM mode of CSCS and the WPCS commands In this CUSTOM mode when you enter a string it is converted into the GSM alphabet using the Custom To GSM table In a similar way when the user requests a string display the string is converted from the GSM alphabet using the Custom alphabet and Custom alphabet extension tables In edition mode the session is terminated by lt ctrl Z gt or aborted by lt ESC gt Only hexadecimal characters 0 9 A F can be used The number of characters entered must equal the edition range requested otherwise the command will return CME ERROR 24 The default Custome alphabet extension table contains the following extended characters mode 0 Display the table 1 Editthe table table 0 Custom to GSM conversion table default table is PCCP437 to GSM table 1 Custom alphabet table default table is GSM 7 bit default alphabet 2 Custom alphabet extension table default table is GSM 7 bit default alphabet extended char 1 gt char 2 Character range to display edit 0 127 for table 1 and 2 0 25
177. ctive is SIM dependent Selection of the FD phonebook with lt pin2 gt when lt pin2 gt is already verified will give the error CME ERROR 3 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 46 Chapter 8 Phonebook Commands Read Phonebook Entries CPBR Description This command returns phonebook entries for a range of locations from the current phonebook memory storage selected with CPBS Note For all phonebook read commands CPBR CPBF CPBN CPBP CNUM the TON NPI MSB of each number is set to 1 ex a TON NPI stored as 17 is displayed as 145 If the AT WCOS 1 command has been used the response will include Contact structure Values lt first_entry gt lt last_entry gt Location or range of locations of the phonebook entry or entries lt type TON NP gt Type of address byte in integer format Value is 145 if the dialing string lt number gt response value includes the international access code character otherwise the value is 129 Syntax Command Syntx AT CPBR Response Syntax e The entry is stored in the ADN phonebook and AT WCOS 0 lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the ADN phonebook and AT WCOS 1 lt CR gt lt LF gt CPBR lt loc gt lt num gt lt type gt lt name gt lt Phb_group gt lt CR gt lt LF
178. d Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 160 Chapter 15 GPRS Commands GPRS Network Registration Status CGREG Description The set command controls the presentation of an unsolicited result code CGREG lt stat gt when lt n gt 1 and there is a change in the modem s GPRS network registration status or code CGREG lt stat gt lt lac gt lt ci gt when lt n gt 2 and there is a change of the network cell The read command returns the status of result code presentation and an integer lt stat gt which shows whether the network has currently indicated the registration of the modem Location information elements lt lac gt and lt ci gt are returned only when lt n gt 2 and modem is registered in the network Values lt n gt 0 Disable network registration unsolicited result code 1 Enable network registration unsolicited result code CGREG stat 2 Enable network registration and location information unsolicited result code CGREG lt stat gt lt lac gt lt ci gt lt stat gt 0 Not registered the modem is not currently searching a new operator to which to register 1 Registered home network 2 Not registered but modem is currently searching a new operator to which to register 3 Registration denied 4 Unknown 5 Registered roaming lac String type two byte location area code in hexadecimal format ci String type two byte cell ID in hexadecimal format Syntax
179. d Insertion and Removal ssssse 11 SIM Conditions Gall Control Commands Lists rnit iem eint 193 Data Commands ISU s erui cien remite PRESE Ed 195 General Commands List eesssssssssss 193 GPRS Commands List uini oic orbit eM eant 197 Network Service Commands List 194 Phonebook Commands List iiie 194 security Commands List entere teres 194 Short Messages Commands List 194 SIM Toolkit Commands List sssssssse 196 Specific AT Commands LISt eiae ote cie dete 196 Supplementary Commands List 195 V24 V25 Commands List 195 SIM Conditions for Command Execution and Dependence 193 SIM for UCS2 Coding of Alpha Fields 191 SIM Toolkit Error Cod es 5 ertet 140 SIM ToolKit Get Information STGI 143 SIM ToolKit Give Response STGR 146 SIM ToolKit Indication STIN or STRIL 142 SIM ToolKit Set Facilities STSF 140 Single Numbering Scheme CSNS 24 Speaker amp Microphone Selection SPEAKER 26 Specific Error Result Codes rrisin 174 Status Request amp MSTR ceci corteo tette ee ipee 121 Structure of Terminal Profile eesseuuuss 188
180. dType 1 Display text Prior 0 Normal priority of display 1 High priority of display Text Text to display in ASCII format lt ClearMode gt 0 Clear message after a delay 3 seconds 1 Wait for user to clear message Values when CmdType 2 Get Inkey lt Format gt 0 Digit 0 9 Z and 1 SMS alphabet default 2 UCS2 lt HelpInfo gt 0 No help information available 1 Help information available TextInfo Text information in ASCII format Values when CmdType 3 Get Input Format 0 Digit 0 9 and 1 SMS alphabet default 2 UCS2 3 Unpacked format 4 Packed format lt EchMode gt 0 Echo off 1 Echo on lt SizeMin gt 1 255 Minimum length of input lt SizeMax gt 1 255 Maximum length of input HelpInfo 0 No help information available 1 Help information available TextInfo Text information in ASCII format Values when CmdType 4 Setup Call Type 0 Set up call but only if not currently busy on another call 1 Set up call putting all other calls if any on hold 2 Set up call disconnecting all other calls if any lt CalledNb gt Called party number in ASCII format lt SubAdress gt Called party sub address in ASCII format lt Class gt 0 Voice call 1 Data call lt Alpha Id gt Values when CmdType 5 Play tone lt ToneType gt 0 Tone Dial 1 Tone Busy 2 Tone Congestion 3 Tone Radio ack 4 Tone Dropped 5 Tone Error 6 Tone Call waiting 7 Tone Ringing 8 Tone General beep 9 Ton
181. de is returned AT WMBS WMBS 0 3 4 0 1 OK Note Only 850 mono band or 850 1900 bi band are available AT WMBS WMBS 01 2 3 4 5 6 0 1 OK Note All bands are available Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 137 Chapter 14 SIM Toolkit Chapter 14 SIM Toolkit Overview of SIM Application Toolkit SIM Toolkit also known as SIM Application Toolkit introduces new functionalities which open the way to a broad range of value added services The principle is to allow service providers to develop new applications e g for banking travel ticket booking etc for subscribers and to download them into the SIM This solution allows new services to be accessible to the user by adding new SIM based applications without modifying the handset Functionality The term S M Toolkit refers to the functionalities described in the GSM Technical Specification 11 14 It introduces about twenty five new commands for the SIM Three classes of Toolkt functionalities have been defined with Class 1 offering a subset of commands and Class 3 offering the full range of commands See the Support of SIM Toolkit Classes table in APPENDIX D The SIM Application Toolkt supports e profile download proactive SIM data download into SIM menu selection call control by SIM Profile Download The Profile Download instruction is sent by the customer application to the SIM as part of the
182. dicating the number of characters in the string The third byte contains an 8 bit number that defines bits 15 to 8 of a 16 bit base pointer where bit 16 is set to zero and bits 7 to 1 are also set to zero These sixteen bits represent a base pointer to a half page in the UCS2 code space to be used with some or all of the remaining bytes in the string The fourth and subsequent bytes in the string contain codings as follows e If bit 8 of the byte is set to zero the remaining bits of the byte contain a GSM Default Alphabet character e If bit 8 of the byte is set to one then the remaining bits are an offset value added to the 16 bit base pointer defined by byte 3 and the resulting 16 bit value is a UCS2 code point and defines a UCS2 character Example 2 In the above example e Byte 2 indicates there are 5 characters in the string e Byte 3 indicates bits 15 to 8 of the base pointer and indicates a bit pattern of Ohhh hhhh h000 0000 as the 16 bit base pointer number Bengali characters for example start at code position 0980 0000 1001 1000 0000 which is indicated by the coding 13 in byte 3 shown by the italicized digits e Byte 4 indicates GSM Default Alphabet character 53 e g S e Byte 5 indicates a UCS2 character offset to the base pointer of 15 expressed in binary as follows 001 0101 which when added to the base pointer value results in a sixteen bit value of 0000 1001 1001 0101 e g 0995 which is the Bengali
183. duct will then answer with ERROR All modulation control error control and data compression commands are not recognized An ERROR string will be returned GSM 07 05 Recommendation All the 07 05 commands not described in this manual are not implemented The product will answer ERROR to these commands GSM 07 07 Recommendation All the 07 07 commands not described in this manual are not implemented The product will answer ERROR to these commands Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 171 Appendix A Result Codes Failure Causes Other Tables Appendix A Result Codes Failure Causes Other Tables Chapter Summary The following tables are included in Appendix A e ME error result code CME ERROR error e Message service failure result code x CMS ERROR lt er gt e Specific error results codes e Failure Cause from GMS 05 08 recommendation CEER e Specific Failure Cause for CEER e GSM 04 11 Annex E 2 Mobile originating SM transfer e Unsolicited result codes e Final result codes e Intermediate result codes e Parameter storage e GMS sequences list e Operator names e CPHS Information field e CSP constraints Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 172 Appendix A Result Codes Failure Causes Other Tables ME Error Result Code CME ERROR lt error gt Meaning Resulting from t
184. e ADN phonebook and AT WCOS 0 lt CR gt lt LF gt CPBP lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the ADN phonebook with AT WCOS 1 lt CR gt lt LF gt CPBP lt loc gt lt num gt lt type gt lt name gt lt Phb_group gt e The entry is stored in the Mobile Equipment phonebook with AT WCOS 0 lt CR gt lt LF gt CPBP lt loc gt lt num gt lt type gt lt name gt e The entry is stored in the Mobile Equipment phonebook with AT WCOS 1 lt CR gt lt LF gt CPBP lt loc gt lt num gt lt type gt lt name gt lt Contact gt lt Phb_group gt Command Possible responses AT CPBP Note Test command CPBP 1 50 20 10 OK Note 50 locations from 1 to 50 maximum length for phone number is 20 digits 10 characters maximum for the text AT CPBP 331290101 Note Search entries corresponding to this phone number CPBP 15 331290101 145 Eric OK Note Display the entry corresponding to the specified phone number AT CPBP 331290101 Note Search entries corresponding to this phone number CPBP 15 01290101 129 Eric OK Note Display the entry corresponding to the specified phone number AT CPBP 01290202 Note Search entries corresponding to this phone number CPBP 15 4 331290202 145 David OK Note Display the entry corresponding to the specified phone number AT CPBP 331288575 Note Search entries corresponding to
185. e Equipment phonebook with AT WCOS 1 AT CPBWs lt index gt lt number gt lt type gt lt text gt lt contact gt Phb_group gt Command Possible responses AT CPBS SM Note ADN phonebook OK Note phonebook not extended AT CPBS CPBS7SM 1 10 Note Which phonebook is selected OK Note ADN phonebook is selected 1 location is used and 10 locations are available AT WCOS 0 OK AT CPBW CPBW 1 50 20 129 145 10 Note Test command OK Note 50 locations phone number 20 digits max TON NPI of 129 or 145 text length 10 AT CPBW 5 112 129 SOS OK Note Write at location 5 Note Location 5 written AT CPBR 5 CPBR 5 112 129 SOS Note Read the entry at location 5 Note Location 5 written AT CPBS CPBS7SM 2 10 Note Which phonebook is selected OK Note ADN phonebook is selected 2 locations are used and 10 locations are available Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 49 Chapter 8 Phonebook Commands CPBW Command Table Continued Command Possible responses AT CPBW 5 01290917 129 Jacky OK Note Overwrite location 5 Note Location 5 overwritten AT CPBW 6 01292349 129 8000410042 OK Note write location 6 UCS2 format for the lt text gt field Note Location 6 is written AT CPBW 8 01292349 129 80xyz OK Note write location Note
186. e Positive beep 10 Tone Negative beep lt TimeUnit gt 0 Time unit used is minutes 1 Time unit used is seconds 2 Time unit used is tenths of seconds lt Timelnterval gt 1 255 Time required expressed in units TextInfo Text information in ASCII format Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 144 Chapter 14 SIM Toolkit Values when CmdType 6 Sel Item Defaultltem 1 255 Default Item Identifier Alpha Idenitifer menu Alpha identifier of the main menu lt Idx gt 1 255 Identifier items lt Nblitems gt 1 255 Number of items in the menu lt Alpha Idx Label gt Alpha identifier label of items in ASCII format lt HelpInfo gt 0 No help information available 1 Help information available lt NextActionld gt Contains a pro active command identifier see the table in APPENDIX F Values when CmdType 7 Refresh lt RefreshType gt 0 SIM initialization and full file change notification 1 File change notification 2 SIM initialization and file change notification 3 SIM initialization 4 SIM reset Values when CmdType 8 Send SS TextInfo Text information in ASCII format Values when CmdType 9 Send SMS TextInfo Text information in ASCII format Values when CmdType 10 Send USSD Textlnfo Text information in ASCII format Values when CmdType 11 Setup Event List lt Evt gt 1 Reporting asked for an Idle Screen event 2 Reporting asked for an User Ac
187. e Voice Parameters VIP 30 Microphone Mute Control CMUT 26 Redial Last Telephone Number DL 22 Remote Disconnection A 21 SideTone Modification SIDET 30 Single Numbering Scheme CSNS 24 Speaker amp Microphone Selection SPEAKER 26 Commands Data Bearer Type Selection CBST ssuus 93 Cellular Result Codes CRC sesss 95 DTE DCE Local Rate Reporting ILRR 95 Others Radio Link Parameters DOPT 96 Radio Link Protocol Parameters CRLP 96 Select Data Compression 0 sessusee 97 Select Data Error Correcting Mode N 98 Select Mode FCLASG ccccccssssecesseeeeeessteeeeenes 94 Service Reporting Control CR uessesss 94 V42bis Data Compression DS 97 V42bis Data Compression Report DR 98 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S000293l 199 Commands General Pin Remaining Attempt Number CPINC 42 Alarm Management CALA sse 18 Commands Short Messages Capabilities list 7GGAP sinc nein 15 Cell Broadcast Message Identifiers WCBM 75 Card Identi
188. e current negotiated or renegotiated DTE DCE rate If enabled the intermediate result code is transmitted in an incoming or outgoing data call after any data compression report and before any final result code CONNECT Values lt value gt 0 Disable local port rate report 1 Enable local port rate report rate Can take the following values 300 600 1200 2400 4800 9600 19200 38400 57600 115200 Kbps Syntax Command syntax AT ILRR value Command Possible responses AT ILRR 0 OK Note Local port rate report disabled Note Command valid AT ILRR 1 OK Note Local port rate report enabled Note Command valid AT ILRR ILRR 1 OK AT ILRR ILRR 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 95 Chapter 11 Data Commands Radio Link Protocol Parameters CRLP Description This command changes the radio link protocol parameters used for non transparent data transmission Values Value Range Description lt iws gt 0 61 Down window size default is 61 lt mws gt 0 61 Up window size default is 61 T1 40 255 Acknowledgement timer in units of 10ms default is 48 N2 1 255 Retransmission attempts default is 6 ver 0 1 Version number 0 V42bis is not supported 1 V42bis is supported Syntax Command syntax AT CRLP lt iws gt lt mws gt lt T1 gt lt N2 gt ver Command Possible responses AT CRLP CRLP
189. e responses AT CPHS 2 5 WNON 0 Orange F Note Get Operator Name OK AT CPHS 2 5 1 WNON 1 Orange Note Get short format Operator Name OK AT CPHS 2 5 0 CME ERROR 3 Note CPHS feature is not allowed or format name is not accessible AT CPHS 2 5 1 CME ERROR 3 Note CPHS feature is not allowed or format name is not accessible AT CPHS 0 5 OK Note Deactivatation of Network Note No effect Operator Name feature CPHS Information WCPI Description Values Syntax This indication provides CPHS information i e which data fields are present in the SIM This command is the response to the AT CPHS 2 6 lt data field gt command lt data field gt value indicating the field of CPHS information If precision field is omitted in the AT CPHS command all fields of CPHS Information will be displayed status 0 data field is set 1 data field is unset When all CPHS Information is requested the status corresponds to a bit field See Codes and Values in the Appendix Note The field CSP Service data field 1 is used to set the CSP feature at initialization Command Syntax AT CHPS 2 6 lt data field gt Response Syntax WCPI data field gt lt status gt Command Possible responses AT CPHS 2 6 WCPI 0 0033000F Note Get current status for all CPHS Information fields OK AT CPHS 2 6 13 WCPI 13 1 Note Get the current status of Call Forward Activated OK I
190. ech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 108 Chapter 13 Specific AT Commands General Indications WIND Description This command provides a general mechanism to send unsolicited non standardized indications to the application The indicators are e Indication of a physical change on the SIM detect pin from the connector meaning SIM inserted SIM removed e Indication during mobile originated call setup that the calling party is ringing e Indication of the availability of the product to receive AT commands after boot e NITZ indication Network Information and Time Zone For each of these indications a bit flow has to be indicated Values lt IndLevel gt 0 No unsolicited WIND lt IndNb gt will occur Default 1 bit 0 Hardware SIM Insert Remove indications or SIM presence after software reset 2 bit 1 Calling party alert indication 4 bit 2 Product is ready to process AT commands except phonebooks AOC SMS but still in emergency mode 8 bit 3 The product is ready to process all AT commands at the end of init or after swapping to ADN in case of FDN configuration 16 bit 4 A new call identifier has been created after an ATD command CCWA indication 32 bit 5 An active held or waiting call has been released by network or other party 64 bit 6 Network service available indication 128 bit 7 Network lost indication 256 bit 8 Audio ON indication 512
191. ech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 85 Chapter 10 Supplementary Services Commands Accumulated Call Meter Maximum CAMM Description The set command sets the Advice of Charge related to accumulated call meter maximum value in SIM file EF acmmax ACMmax contains the maximum number of home units the subscriber is allowed to consume When ACM see CACM reaches ACMmax calls are prohibited SIM PIN2 is required to set the value If setting fails in an ME error CME ERROR lt err gt is returned The Read command returns the current value of ACMmax The ACMmax value entered or displayed is in hexadecimal format with 6 digits Values lt ACMmax gt String type coded as lt ccm gt under CAOC Value 0 disables ACMmax feature lt pin2 passwd gt String type Syntax Command syntax AT CAMM lt ACMmax gt lt pin2 passwd gt Command Possible responses AT CAMM 000400 1234 OK Note Request ACMmax update PIN2 is 1234 Note ACMmax updated to 1024 AT CAMM 000400 0000 CME ERROR 16 Note Request ACMmax update PIN2 is 1234 Note Incorrect password AT CAMM CAMM 000400 Note Request ACMmax value OK Note ACMmax 1024 Price Per Unit and Currency Table CPUC Description The set command sets the parameters for Advice of Charge related to price per unit and the currency table in SIM file EFpucr PUCT information can be used to convert the home units
192. ed Capabilities List GCAP Description Displays the complete list of capabilities Values No parameters Syntax AT GCAP Command Possible responses AT GCAP GCAP CGSM FCLASS Note Get capabilities list OK Note Supports GSM and FAX commands Repeat Last Command A Description Repeats the previous command Only the A command itself cannot be repeated Values No parameters Syntax A Command Possible responses A Note Repeat last command Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 Chapter 4 General AT Commands Power Off CPOF Description Values Syntax Stops the GSM software stack as well as the hardware layer or modem activity The AT CFUN 0 command is equivalent to CPOF No parameters AT CPOF 1 Command Possible responses AT CPOF OK Note Stop GSM stack Note Command valid AT CPOF 1 OK Note Stop the modem Note Command valid Note After AT CPOF 1 the modem will not respond to AT commands To reset it use the hard reset Note n autobaud mode after an AT CPOF unsolicited information that wakes up the modem is sent at 9600 bps until an AT command is sent When an AT command is sent the modem will synchronize to the sender s speed Caution When starting up if autobauding is enabled and no AT command has yet been received the product sends all unsolicited responses
193. ed Password maximum length is given with the AT CPWD Command Note It will not possible to lock the FDN phonebook if this one is not loaded Syntax Command syntax AT CLCK lt fac gt lt mode gt lt passwd gt lt class gt Response syntax CLCK status lt class1 gt lt CR gt lt LF gt CLCK status class2 Command Possible responses AT CLCK SC 1 1234 OK Note Enable PIN Note PIN was correct AT CLCK CLCK PS 0 SC 0 FD 0 PN 0 PU 0 PP 0 PC 0 Note Read PIN status OK Note PIN is enabled no SIM lock no network lock no information on Call barring no longer supported in GSM Technical Specification 07 07 AT CLCK SC 0 5555 CME ERROR 16 Note Disable PIN Note PIN was wrong AT CPIN 1234 OK Note Enter PIN Note PIN was good AT CLCK CLCK PS SC AO Ol OX Al IR AB AC Note Request supported FD PN PU PP PN facilities OK Note Supported facilities AT CLCK PN 1 12345678 OK Note Activate network lock Network lock activated AR CLCK A0 1 1234 2 OK Note Activate all outgoing calls Note Call barring is activate except data calls AT CLCK AO 2 CLCK 1 2 Note Query BAOC status OK Note BAOC activate for data calls only AT CLCK SC 0 0000 CME ERROR 521 Note Disable PIN Note PIN deactivation is forbidden w
194. ed by the SIM Values lt CmdTreated gt 0 The command must be treated by the application 1 The is already treated by the modem lt Command string gt string type SIM command string in hexadecimal format Syntax STRIL lt CmdTreated gt lt Command string gt Last SIM Toolkit Indication The last SIM Toolkit indication sent by the SIM can be requested by the AT STIN command This command is only usable between the sending of the STIN indication by the SIM Step 2 Messages exchanged during a SIM Toolkit operation and the response of the user with the STGI command Step 3 Syntax Command syntax AT STIN indication sent by the SIM been already used Command Possible responses AT STIN Note Ask for the last SIM Toolkit STIN 0 indication sent by the SIM OK Note the last SIM Toolkit indication was a Setup Menu AT STGI 0 Note Display the SIM Toolkit application menu AT STIN CME ERROR 4 Note Ask for the last SIM Toolkit Note Operation not supported The STGI command has Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 142 Chapter 14 SIM Toolkit SIM Toolkit Get Information STGI Description This command allows to get the information text to display menu information priorities of a pro active command sent from the SIM The information is returned only after receiving a SIM Toolkit indication STIN Values V
195. efore connecting to the network This gives the SIM the ability to allow bar or modify the string before the operation starts The commands used for this operation are STCR SIM Toolkit Control Response STGR SIM Toolkit Give Response Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 138 Chapter 14 SIM Toolkit Messages Exchanged During a SIM Toolkit Operation The following scheme shows the SIM Toolkit commands and unsolicited results that are exchanged S TSF X XXXXXXXX STEP 1 Configuration and Activation STIN X STEP 2 SIM sends pro active command MULTI TECH Customer Modem 4STGI X Application STGI response TEP 3 Customer application gets all the information STCR X STGR X XXXXXX STEP 4 User response is sent to the SIM Step 1 The customer application informs the modem which facilities are supported This operation is performed with the STSF SIM Toolkit Set Facilities command which also activates or deactivates the SIM Toolkit functionality Step 2 An unsolicited result STIN SIM Toolkit indication is sent by the product in order to indicate to the customer application which command type the SIM Application Toolkit is running The last SIM Toolkit indication can be requested by the STIN command Step 3 The customer application uses the STGI S M Toolkit Get Information command to get all the information about the SIM Toolkit command g
196. en the BT chip is switched on the GPIOS5 is not available anymore Values index Up to ten I O ports are available The index value is between 0 and 9 value 0 I O port number index is reset 1 I O port number index is set Syntax Command syntax AT WIOR lt index gt Response syntax WIOR lt value gt Command Possible responses AT WIOR 0 WIOR 0 Read I O number 0 value OK GPIO number 0 is reset Write GPIO Value WIOW Description Set the requested GPO or GPIO pin value Notes e By default e g after a reset the I O ports configuration is set by the WIOM command e This command is allowed only on a GPIO not allocated by an Open AT embedded application or for bus operations e When the BT chip is switched on the GPIO5 is not available anymore It is not possible to change the state of the GPIO using this command Values index Up to ten I O ports are available The index value is between 0 and 9 value 0 I O port number index is reset 1 I O port number index is set Syntax Command syntax AT WIOW lt index gt lt value gt Command Possible responses AT WIOW 2 0 OK Reset I O number 2 GPIO value is written Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 114 Chapter 13 Specific AT Commands Input Output Management WIOM This command sets the default GPIO s configuration input or outp
197. eq Sets tone frequency in Hz mandatory if mode 1 lt freq2 gt Sets the 2 tone frequency in Hz mandatory if lt mode gt 1 Available with speaker only If lt dest gt 1 speaker Range is 1 Hz to 3999 Hz If lt dest gt 2 buzzer Range is between 1 Hz and 50000 Hz lt gain gt Sets the tone gain for the lt freq gt The default is 9 lt gain2 gt Sets the tone gain for the lt freq2 gt The default is 9 Range of values is 0 to 15 lt gain gt Speaker db Buzzer db o 0 0 25 05 2 4 3 1 5 4 2 5 3 6 6 6 7 9 9 8 12 9 15 10 18 11 24 12 30 13 40 14 infinite 15 infinite infinite lt duration gt Sets tone duration unit of 100 ms Range is 0 to 50 Default 0 1 gt 0 1 s 50 gt 5 s When this lt duration gt 0 the duration is infinite and the tone can be stopped by AT WTONE 0 Note The frequency lt freq2 gt and gain lt gain2 gt are allowed for the speaker only Caution Hardware can only generate the following frequencies Freq 13 000 000 N 64 N Interger value in the recommended range 1 to 2048 With N 1 the frequency 203 125 Hz is generated With N 2048 the frequency 99 18 Hz is generated Some noise problems have been detected if the frequency is below 100 Hz The lowest frequency possible is 12 Hz Command syntax AT WTONE lt mode gt lt dest gt lt freq gt lt gain gt lt duration gt lt freq2 gt gain2 gt
198. er 2 protocol termination procedure completion the V 25ter command state is re entered and the modem returns the final result code OK In case of an abnormal termination or start up the V 25ter command state is re entered and the modem returns the final result code NO CARRIER or if enabled CME ERROR Attach activate and other errors may be reported This command may be used in both normal and modem compatibility modes Note The goal of this command is the same than ATD 99 If aGPRS PPP session is already running the setting of a CSD GSM data call is not supported lt cid gt A numeric parameter which specifies a particular PDP context definition Command Syntax AT CGDATA Command Possible Response s AT CGDATA lt cid gt CONNECT ERROR AT CGDATA CGDATA OK AT CGDATA CGDATA OK AT CGDATA 1 CONNECT Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 157 Chapter 15 GPRS Commands GPRS Mobile Station Class CGCLASS Description Values The set command is used to set the modem to operate according to the specified GPRS mobile class If the requested class is not supported an ERROR or CME ERROR response is returned The read command returns the current GPRS mobile class The test command is used for requesting information on the supported GPRS mobile classes lt class gt A string parameter which indicates the GPRS mobile class in descending order of f
199. errogate value OK Note Default receive gain AT VGR VGR 0 255 Note Test command OK Note Possible values AT VGT VGT 32 Note Interrogate value OK Note Default transmit gain AT VGT VGT 0 255 Note Test command OK Note Possible values Note For the AT VGT command with controller 1 the value is the lower value of range whereas with controller 2 the value corresponds to the entered value using AT VGT xx Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 24 Chapter 5 Call Control Commands The application sends the following Controller 1 Controller 1 2 MENN 2 O 1 j 0db j e x i li 19 95d sen 8 p 10 5 db 2 11 db 23 11 5 db 58 29 db 59 29 5 db 60 30 db 61 30 5 db 62 31 db 101 50 5 db 102 to 127 51 db 128 to 243 6 5 db 244 6 db 245 5 5 db 246 5 db 255 0 5 db The gain values listed here are relative for absolute electrical values please refer to the specific hardware documentation of the module used in the application Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 25 Chapter 5 Call Control Commands Microphone Mute Control CMUT Description This command mutes the microphone input on the product for the active microphone set with the SPEAKER command This command is only allowed du
200. es that a Display Text pro active command has been sent from the SIM Indicates that a Get Inkey pro active command has been sent from the SIM Indicates that a Get Input pro active command has been sent from the SIM Indicates that a Setup Call pro active command has been sent from the SIM Indicates that a Sel Item pro active command has been sent from the SIM Indicates that a Refresh pro active command has been sent from the SIM Indicates that a Send SS pro active command has been sent from the SIM 2 3 4 5 Indicates that a Play Tone pro active command has been sent from the SIM 6 7 8 9 Indicates that a Send SMS pro active command has been sent from the SIM 10 Indicates that a Send USSD pro active command has been sent from the SIM 11 Indicates that a SETUP EVENT LIST pro active command has been sent from the SIM 93 An SMS PP Download failed due to SIM BUSY 94 An SMS PP Download failed due to SIM ERROR 98 Indicates the timeout when no response from user 99 Indicates that a End Session has been sent from the SIM if the automatic response parameter is activated this indication is followed by the corresponding STGI response Second SIM Toolkit Indication If the customer application needs to exchange a SIM Toolkit message directly with the SIM card the second indication STRIL gives the full command string provid
201. ese locks Values fac PS SIM lock facility with a 8 digits password PCK PN Network lock with a 8 digits password NCK PU Network subset lock with a 8 digits password NSCK PP Service provider lock with a 8 digits password SPCK PC Corporate lock with a 8 digits password CCK lt psswd gt password code 8 digits Netld IMSI for SIM lock fac PS operator in numeric format MCC and MNC for other locks other fac values lt GID1 gt Group Identifier level 1 mandatory for Service provider lock lt fac gt PP and for Corporate lock lt fac gt PC lt GID2 gt Group Identifier level 2 mandatory for Corporate lock lt fac gt PC CnlType Type of lock for co operative network list CNL 0 Automatic co operative network list retrieved from EFCNL SIM file Note EFCNL file must be present in SIM to use automatic mode 1 Manual co operative network list is given in the CnlData parameter CnlData Co operative network list hexa string type using same format as in EFCNL SIM file ETSI GSM 11 11 or 3GPP 04 08 Note Only if CnlType 1 Syntax Command syntax AT WLCK lt fac gt lt passwd gt lt Netld gt lt GID1 gt GID2 lt CnlType gt lt CnIData gt Response syntax WLCK lt status gt Command Possible responses AT WLCK PN 12345678 20810 OK Note Activate network lock on SFR 208 10 Note Network lock activated AT WLCK PS 12345678 20810
202. esentation AT COLP 0 OK Note Deactivate COLP Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 84 Chapter 10 Supplementary Services Commands Advice of Charge CAOC Description Values Syntax This refers to the Advice of Charge supplementary service GSM 02 24 and GSM 02 86 which enables the subscriber to obtain information on call cost With lt mode gt 0 the command returns the current call meter value CCM from the modem ME If AOC is supported the command can also enable unsolicited event reporting on CCM information The unsolicited result code CCCM ccm is sent when the CCM value changes Deactivation of unsolicited event reporting is performed with the same command If AOC is supported the Read command indicates whether unsolicited reporting is activated or not mode 0 Query COM value 1 Deactivate the unsolicited reporting of CCM value 2 Activate the unsolicited reporting of CCM value ccm String type three bytes of the current call meter value in hexadecimal format e g O0001E corresponds to the decimal value 30 value is in home units and bytes are coded in a similar way as the ACMmax value in SIM Command syntax AT CAOC mode Command Possible responses AT CAOC 0 CAOC 000A08 Note Query CCM value OK Note Display Current Call Meter value CCM 2568 AT CAOC 1 OK Note Deactivate un
203. est Note Read entries Test CPBF 1 0123456789 129 Test ME Note Display locations with text field starting with Test AT WCOS 1 Note Phonebook extended OK AT CPBF Test Note Read entries with Test CPBF 1 70123456789 129 Test ME 9876543210 129 email mail address com post address 0 Note Display locations with text field starting with Test extended entry Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 52 Chapter 8 Phonebook Commands Phonebook Phone Search CPBP Description This command orders the product to search the phonebook for an item with the same phone number as that defined in the parameter The searched phone number is the FIRST one that the user can enter with AT CPBW For example with this command strin we can search only the phone number 331290909 AT CPBW 13 331290909 145 Fred 0141284549 129 0600003210 129 0141280000 129 019876543210 129 fred 9 mail address com Becker Street London 0 Values lt PhoneNumber gt lt loc gt lt num gt lt type gt lt contact gt Syntax Command Syntax Response Syntax Phone number coded according to any GSM 07 07 or GSM 07 05 phone number Location number Phone number TON NPI type of address octet in integer format Contact structure AT CPBP lt PhoneNumber gt e The entry is stored in th
204. established and the ME is in command mode this command allows you to return to online data mode Values No parameters Syntax Command syntax ATO Command Possible responses ATO OK Return from offline mode to online mode Result Code Suppression Q Description This command determines whether the mobile equipment sends result codes or not Values n 0 DCE transmit result codes 1 Result codes are suppressed and not transmitted Syntax Command syntax ATQ lt n gt Command Possible responses ATQO OK Note DCE transmits result codes Note Command valid ATQ1 Note No response Note Result codes are suppressed and not transmitted Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 102 Chapter 12 V 24 and V 25 Commands DCE Response Format V Description This command determines the DCE response format with or without header characters lt CR gt lt LF gt Result codes are provided as numeric or verbose Values lt n gt 0 lt n gt 1 Information lt text gt lt CR gt lt LF gt lt CR gt lt LF gt responses lt text gt lt CR gt lt LF gt Result codes numeric code CR lt CR gt lt LF gt verbose code CR LF Syntax Command syntax ATV n Command Possible responses ATVO 0 Note DCE transmits limited headers and trailers and Note Command is valid 0 means OK numeric result codes ATV1 OK
205. etected after a fixed network time out NO CARRIER 3 Call setup failed or remote user release Use the AT CEER command to know the failure cause Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 19 Chapter 5 Call Control Commands Direct Dialing from a Phonebook stored in the SIM card can be performed with the following commands Syntax ATD gt index to call index from the selected phonebook by the CPBS command ATD gt BILL to call BILL from the selected phonebook ATD gt mem lt index gt allows direct dialing from a phonebook number mem is SM LD MC ME RC MT or SN See CPBS command ATD nb I ATD mem index l ATD gt lt mem gt lt name gt lt I gt 5 Command Possible responses AT CPBS CPBS SM 8 10 Note Which phonebook is selected Note ADN phonebook is selected 8 locations are used and 10 locations are available ATD gt SM6 OK Note Call index 6 from AND phonebook Note Call succeeds When the FDN phonebook has been locked only numbers beginning with the digits of FDN phonebook entries can be called For example if 014629 is entered in the FDN phonebook all the phone numbers beginning with these 6 digits can be called The CLIR supplementary service subscription can be overridden for this call only means invocation restrict CLI presentation i means
206. ext mode result codes This information can be found in the description of the CMT CMGR CMGL commands Values lt n gt show indicator 0 donot show header values 1 show the values in result codes Syntax Command Syntax AT CSDH Command Possible responses AT CSDH 0 OK Note Set value to do not how AT CSDH CSDH 0 Note Current value OK Note Do not show header values Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 65 Chapter 9 Short Messages Commands New Message Indication CNMI Description Values This command selects the procedure for message reception from the network lt mode gt Controls the processing of unsolicited result codes Important Note Only lt mode gt 2 is supported lt bm gt lt ds gt Any other value for mode 0 1 or 3 is accepted return code will be OK but the processing of unsolicited result codes will be the same as with lt mode gt 2 Buffer unsolicited result codes in the TA If TA result code buffer is full indications can be buffered in some other place or the oldest indications may be discarded and replaced with the new received indications Discard indication and reject new received message unsolicited result codes when TA TE link is reserved Otherwise forward them directly to the TE Buffer unsolicited result codes in the TA when TA TE link is reserved and flush them to the TE after reservation
207. f the GPRS multislot class Slow CONNECT for PALM OS PPP Filtering Automatic GPRS roaming inter operator if activated the modem automatically re attaches itself to the network and reactivates its PDP context by changing the operator when reaching border areas If lt mode gt 0 1 3 4 5 6 or 7 cid and class will be ignored If lt mode gt 0 1 2 3 5 or 6 class will be ignored If lt mode gt 4 parameter and cid will be ignored The modem must be restarted to take the modification into account PPP Filtering is a test purpose functionality It avoids sending some OS specific frames on the radio link for accurate transfer rate measurements parameter A numeric parameter that controls the operation defined by mode if it is equal to 0 1 2 0 1 cid class Notes or 3 Operation Off disabled Operation On enabled PDP Context Identifier A numeric parameter that specifies a particular PDP context definition The parameter is local to the DTE modem interface and is used in other PDP context related commands The range of values is 0 to 4 GPRS multislot class number It may be loser than the maximum possible class Possible values are 2 8 10 12 Note that the range of values is dependent upon the modem Multislot Maximum Minimum Number of Type Class Number of Slots Slots of MS Rx Tx Sum Tia Tib li Tib 2 2 1 3 3 2 3 1 1 8 4 1 5 3 1 2 1 1 10 4 2 5 3
208. h memory AT WCOS 1 OK Note Contact selected AT CPBR 13 CPBR 13 331290909 145 Fred Note Read entry 0141284549 129 0600003210 129 0141280000 129 019876543210 129 fred mail_address com Becker Street London 1 OK Note Display locations 13 with location number type TON NPI Text and Contact and Phonebook Group n1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 47 Chapter 8 Phonebook Commands CPBR Command Table Continued Command Possible responses AT CPBS SM OK Note ADN phonebook AT CPBR 1 CPBR 1 0123456 129 test OK AT CPBW 1 0123456 OK test Note Add an external entry in the SIM with group number 1 AT CPBR 1 CPBR 1 0123456 129 test 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 48 Chapter 8 Phonebook Commands Write Phonebook Entry CPBW Description This command writes a phonebook entry in location number lt index gt in the current phonebook memory storage Notes e RC and MC phonebooks could be erased only by CPBW Adding a field and or modifying a field is not allowed for these phonebooks e This command is not allowed for EN LD MC RC MT and SN phonebooks they cannot be written e f the AT WCOS 1 command was used the request would include the
209. hanged for outgoing calls and configured for incoming calls AT WVR 6 CME ERROR 3 Note Syntax error Note Syntax error AT WVR WVR 1 1 Note Ask for the current values OK AT WVR WVR 0 2 3 0 2 3 Note If Half Rate is available AT WVR WVR 0 1 0 1 Note If EFR available AT WVR WVR 0 0 Note If neither HR nor EFR is available AT WVR WVR 0 5 15 0 5 15 Note If HR and EFR are available AT WVR WVR 0 2 3 10 11 12 13 14 0 2 3 10 11 12 13 14 Note If Half Rate and AMR are available AT WVR WVR 0 1 6 9 10 11 12 13 0 1 6 9 10 11 12 13 Note If EFR and AMR are available AT WVR WVR 0 10 12 13 0 10 12 13 Note If AMR is available AT WVR WVR 0 15 0 15 Note If HR EFR and AMR are available Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 119 Chapter 13 Specific AT Commands Data Rate WDR Description This command allows the data rate for bearer data to be configured for outgoing and incoming calls Values out coding type Data Coding Type for Outgoing Calls Data Coding Preferred Other Supported Types Default Values Type Type 0 FR Default incoming voice calls rate 1 HR FR 2 FR HR 3 FR HR in coding type Data Coding Type for Incoming Calls Data Coding Type Default Values Type 0 HR 1 FR Default incoming data calls rate
210. hase 2 version AT CMGF 0 OK Note Set PDU mode Note PDU mode valid AT CNMI 2 2 0 0 0 OK Note lt mt gt 2 CMT 29 07913366003000F 1240B913366920547F 3000000300341 9404800 B506215D42ECFE7E17319 Note message received AT CNMA 2 2 lt CR gt gt 00D3 lt Ctrl Z gt Note Negative ACK to the SMS Reason is memory capacity exceeded OK AT CNMA 2 2 lt CR gt gt 00D3 Ctrl Z Note Negative ACK to the SMS Reason is SIM memory storage is full OK AT CNMA 2 2 lt CR gt gt 00D3 lt Ctrl Z gt Note Negative ACK to the SMS Reason is Error in modem OK AT CNMA 2 2 lt CR gt 00FF lt Cirl Z gt Note Negative ACK to the SMS Unspecified error OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 62 Chapter 9 Short Messages Commands Preferred Message Storage CPMS Description This command allows the message storage area to be selected for reading writing etc Values lt mem1 gt Memory used to list read and delete messages It can be SM SMS message storage in SIM default ME SMS message storage in Flash BM CBM message storage in volatile memory SR Status Report message storage in SIM if the EF SMR file exists otherwise in the ME non volatile memory Note SR ME non volatile memory is cleared when another SIM card is inserted It is kept even after a reset while the same SIM card is used mem2 Memory used to w
211. he SIM Description Values mode 0 From SIM to the Flash 1 From the Flash to the SIM loc Location of the SMS to copy mandatory for mode 1 If this location is not defined all the SMS will be copied Note The SMS copied will be placed in the first free location Syntax Command Syntx AT WMCP mode loc Command Possible responses AT WMCP WMCP 0 1 12 WMCP 1 1 99 OK Note The location of the SMS that can be copied from the SIM to the Flash is 1 to 12 maximum available in the SIM The location of the SMS that can be copied from the Flash to the SIM is 1 to 99 the maximum available in the Flash AT CPMS Note Read the SMS storage CPMS SM 3 10 ME 0 99 8M 3 10 OK Note Read write SMS from to SIM 3 SMS are stored in the SIM 10 is the total memory available in SIM No SMS in Flash AT CMGR 1 Note Read the first SMS from the SIM CMGR REC UNREAD 0146290800 98 10 01 18 22 11 00 lt CR gt lt LF gt My test message SMS in the SIM at location 1 OK AT WMCP3 0 1 Note Copy the SMS at location 1 in the SIM to the Flash OK AT CPMS Note Read the SMS storage CPMS SM 3 10 ME 0 99 8M 3 10 OK Note Read write SMS from to SIM 3 SMS are stored in the SIM 10 is the total memory available in SIM No SMS in Flash AT CPMS ME ME ME Note Select ME for reading ME for writing and ME for storing
212. he command will fail The context is activated using the values for PDP type and PDP address provided by the network together with the other information found in the PDP context definition An APN may or may not be required depending on the application If no cid is given the modem will attempt to activate the context using the values for PDP type and PDP address provided by the network together with any other relevant information known to the modem The other context parameters will be set to their default values If the activation is successful data transfer may proceed After data transfer is complete and the layer 2 protocol termination procedure has completed successfully the V 25ter command state is re entered and the modem returns the final result code OK In the event of an erroneous termination or a failure to startup the V 25ter command state is re entered and the modem returns the final result code NO CARRIER or if enabled CME ERROR Attach activate and other errors may be reported It is also an error to issue the CGANS command when there is no outstanding network request This command may be used in both normal and modem compatibility modes response A numeric parameter which specifies how the request should be responded to 0 reject the request 1 accept and request that the PDP context be activated If lt response gt is omitted it is assumed to be 0 Other values are reserved and will result in the ERROR response
213. he current cell in hexa format 3 bytes Daylight Saving Time Integer 0 2 When the LTZ is compensated for DST Daylight Saving Time or summertime the serving PLMN shall provide a DST parameter to indicate it The adjustment for DST can be 1h or 2h Note Forthe NITZ indication all the fields indicated here are optional That is why there is an index related to each of the following e 1 Full name for network e 2 Short name for network e 3 Local time zone e 4 Universal time and local time zone e 5 LSA identity e 6 Network Daylight Saving Time Syntax Command syntax AT WIND lt IndLevel gt Command Possible Responses AT WIND WIND 0 OK AT WIND 255 OK Note The SIM has been removed WIND 0 Note The SIM presence pin has been detected as SIM removed Note The SIM has been inserted WIND 1 Note The SIM presence pin has been detected as SIM inserted Note The network service is available WIND 7 for an emergency call Note The initialization has been WIND 4 completed Note The modem received a NITZ WIND 15 1 Cingular Extended 2 Cingular 3 08 information message 4 03 14 27 16 59 48 08 5 123456 6 2 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 110 Chapter 13 Specific AT Commands Additional Notes e The AT WIND command is supported and indicates the allowed bit flows e AT WIN
214. he following commands Operation not allowed All GSM 07 07 commands CME ERROR 3 Operation not supported All GSM 07 07 commands CME ERROR 4 5 16 Incorrect password CACM CAMM CPUC CLCK CPWD CPIN CPIN2 CME ERROR 16 CPBW FDN CLCK FDN 18 CACM CAMM CPUC CPBW FDN CPIN CPIN2 CLCK FDN CPWD ATD gt mem name Network personal PIN required Network subset All GSM 07 07 commands CME ERROR 42 lock Network personal PIN required Service Provider All GSM 07 07 commands CME ERROR 44 lock requested PLMN updating in this area PH SIM PIN required SIM lock All GSM 07 07 commands CME ERROR 5 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 173 Appendix A Result Codes Failure Causes Other Tables Message Service Failure Result Code CMS ERROR lt er gt is defined as below lt er gt Meanng Resulting from the following commands recommendation 04 11 Annex E 2 PH SIM PIN required Specific Error Result Codes lt error gt Meaning 1 Resultsfromthefollowing commands 500 514 CP error for SMS CMGS CMSS CMS ERROR 514 Please wait init or command processing in progress All commands CME ERROR 515 or CMS ERROR 515 except ATHO ATH1 AT WOIR AT WIOW AT CFUN 1 AT CLCC AT WAC AT CPAS AT VGR AT VTS AT
215. he table GSM 05 08 99 not known or not detectable Syntax AT CSQ Command Possible responses AT CSQ CSQ lt rssi gt lt ber gt OK Note lt rssi gt and lt ber gt as defined below Operator Selection COPS Description There are three possible ways of selecting a Public Land Mobile Network PLMN operator e The product is in manual mode It then tries to find the operator specified by the application and if found tries to register e The product is in automatic mode It then tries to find the home operator and if found tries to register If not found the product automatically searches for another network e The product enters into manual automatic mode and then tries to find an operator as specified by the application as in manual mode If this attempt fails it enters automatic mode If this is successful the operator specified by the application is selected The mobile equipment then enters into automatic mode Note The read command returns the current mode and the currently selected operator In manual mode this PLMN may not be the one set by the application as it is in the search phase These commands are not allowed during communication Values mode 0 automatic default value 1 manual 2 deregistration ME will be unregistered until lt mode gt 0 or 1 is selected 3 set only format for read command AT COPS 4 manual automatic lt oper gt shall be present if manual selection f
216. hich communication is supported 3 Adds a held call to the conversation 4 Connects the two calls and disconnects the subscriber from both calls Explicit Call Transfer Syntax Command syntax AT CHLD lt n gt Command Possible responses AT CHLD lt n gt OK Note If n is within the defined values AT CHLD CHLD 0 4 11 17 21 27 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 87 Chapter 10 Supplementary Services Commands List Current Calls CLCC Description This command returns a list of current calls Values lt idx gt integer type call identification as described in GSM 02 30 lt dir gt direction of the call 0 mobile originated MO call 1 mobile terminated MT call stat state of the call 0 active 1 held 2 dialing MO call 3 alerting MO call 4 incoming MT call 5 waiting MT call mode teleservice 0 voice 1 data 2 fax 9 unknown mpty 0 call is not one of multiparty conference call parties 1 call is one of multiparty conference call parties number string type phone number in format specified by type type type of address byte in integer format alpha optional string type alphanumeric representation of number corresponding to the entry found in phonebook for UCS2 format see commands examples CLIP CCWA or COLP Syntax Command syntax AT CLCC Response syntax OK if no cal
217. ication display up to 1 5 seconds per 64 Kbytes flash sector size can be considered as a maximum all A amp D cells data will be erased IntVersion ASCII string giving the internal Open AT library version lt ExtVersion gt ASCII string giving the external Open AT library version Note If no embedded application is loaded the lt ExtVersion gt parameter does not appear lt A amp DSize gt Usable only with lt mode gt 6 0 1344 Kbytes size allocated for the Application amp Data storage place Default 768 Kbytes Provided parameter value will be updated with the nearest flash sector subdivision 64 Kbytes For example if a 100 Kbytes size is required a 128 Kbytes size will effectively be set lt OATSize gt Returned with lt mode gt 6 Open AT Application reserved size in Kbytes This size is deducted from the lt A amp Dsize gt one since the whole available size for Open AT and A amp D storage places are 1600 Kbytes lt OATSize gt lt A amp Dsize gt 1600 Command syntax AT WOPEN lt Mode gt lt A amp Dsize gt Response syntax according to mode WOPEN lt Modes gt lt IntVersion gt lt ExtVersion gt or WOPEN lt Mode gt lt A amp DSize gt lt OATSize gt Command Possible responses AT WOPEN WOPEN 0 6 0 1344 OK AT WOPEN WOPEN 0 OK AT WOPEN 2 WOPEN 2 AT v3 01 AT v2 10 Note Get the Open AT library OK versions Note Open AT v2 10 library version An embedded a
218. ieved an ERROR or CME ERROR response is returned Extended error responses are enabled by the CMEE command If the modem is not GPRS attached when the activation form of the command is executed the modem first performs a GPRS attach and them attempts to activate the specified contexts If the attach fails then the modem responds with ERROR or if extended error responses are enabled with the appropriate failure to attach error message If no lt cid gt s are specified the activation form of the command activates the first activable defined contexts If no lt cid gt s are specified the deactivation form of the command deactivates all active contexts One PDP context can be activated at the same time The read command returns the current activation states for all the defined PDP contexts The test command is used for requesting information on the supported PDP context activation states Note See Full GPRS AT Command Examples later in this chapter lt state gt Indicates the state of PDP context activation 0 Deactivated 1 Activated Other values are reserved and will result in an ERROR response to the execution command lt cid gt A numeric parameter which specifies a particular PDP context Before a context can be activated the modem must be attached to the GPRS network by performing an automatic GPRS attach Note If a GPRS PPP session is already running the setting of a CSD GSM data call is not supported Command Syntax
219. ime string gt String format for date time is yy MM dd hh mm ss Note Valid years are 98 for 1998 to 97 for 2097 The second field is not mandatory Default date time is 98 01 01 00 00 00 January 1 1998 midnight AT CCLK lt date and time string gt Command Possible responses AT CCLK 00 06 09 17 33 00 OK Note set date to June 9th 2000 and time to 5 33pm Note Date Time stored AT CCLK 00 13 13 12 00 00 Note Incorrect month entered CME ERROR 3 AT CCLK Note Get current date and time OK CCLK 00 06 09 17 34 23 Note current date is June 9th 2000 current time is 5 34 23 pm Alarm Management CALA Sets the alarm date time in the modem The maximum number of alarms is 16 Note The date time should be set with the AT CCLK command prior to using AT CALA date and time string String format for alarms yy MM dd hh mm ss see CCLk Description Values Syntax Note Seconds are taken into account index Offset in the alarm list range 1 to 16 AT CALA lt date and time string set alarm AT CALA lt index gt delete alarm Command Possible responses AT CALA 00 06 09 07 30 Note set an alarm for June 9 2000 at 7 30 am OK Note Alarm stored AT CALA 99 03 05 13 00 00 Note set an alarm for March 5 1999 at 1 00 pm CME ERROR 3 Note Invalid alarm date time expired AT CALA Note
220. ing Line Identification Presentation 83 CLIR Calling Line Identification Restriction 83 GME Error Result Code ceni riter 173 CMEE Report Mobile Equipment errors 17 CMER Mobile Equipment Event Reporting 112 CMGD Delete Message scceseceeseeeeseeeeneeeeeeeteaes 73 CMGF Preferred Message Format 64 40MOL List Messages coq LS oboe si eie tdem ec Lone 69 CMGR Read M ssage serisinin eiin 68 CMGS Send Message sse 70 CMGW Write Message to Memory Ti CMMS More Messages to Send usssus 79 CMS ERROR Message Service Failure Result Code 174 CMSS Send Message from Storage 72 CMUT Microphone Mute Control ss 26 CNMA New Message Acknowledgement 61 CNMI New Message Indication ssss 66 CNUM Subscriber Number sseeesseeeese 55 COLP Connected Line Identification Presentation 84 COPN Read Operator Name sssssesesss 39 COPS Operator Selection 31 CPAS Phone activity Stat S ci eost penes 17 CPBF Find Phonebook Entries suussssse 52 CPBN Move Action in Phonebook sssss 54 CPBP Phonebook Phone Search ss 53 CPBR Read Phonebook
221. ing on incoming calls 254 Call impossible 255 Lower layer failure Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 177 Appendix A Result Codes Failure Causes Other Tables GSM 04 11 Annex E 2 Mobile Originating SM Transfer These error causes could appear for SMS commands CMGS CMSS CMGD Error Error Label Description 1 Unassigned The destination requested by the Mobile Station cannot be reached because unallocated number although the number is in a valid format it is not currently assigned allocated 8 Operator determined The MS has tried to send a mobile originating short message when the MS s barring network operator or service provider has forbidden such transactions 10 Call barred The outgoing call barred service applies to the short message service for the called destination 21 Short message transfer The equipment sending this cause does not wish to accept this short message rejected although it could have accepted the short message This cause is neither busy nor incompatible 27 Destination out of The destination indicated by the Mobile Station cannot be reached because the service interface to the destination is not functioning correctly The term not functioning correctly indicates that a signaling message was unable to be delivered to the remote user e g a physical layer or data
222. initialization It is used to indicate which SIM Application Toolkit features the customer application supports The AT command used for this operation is STSF SIM Toolkit Set Facilities Proactive SIM A proactive SIM provides a mechanism whereby the SIM can ask the customer application to perform certain actions These actions include display menu display given text get user input send a short message play the requested tone set up a call provide location information This mechanism allows SIM applications to generate powerful menu driven sequences on the customer application and to use services available in the network The commands used for this operation are STIN SIM Toolkit Indication STGI SIM Toolkit Get Information STGR SIM Toolkit Give Response Data Download to SIM Data downloading to the SIM allows SMS phonebook data or programs Java applets received by SMS or by Cell Broadcast to be transferred directly to the SIM Application This feature does not need any AT command It is transparent to the customer application Menu Selection A set of menu items is supplied by the SIM Application Toolkit The menu selection command can then be used to inform the SIM Application which menu item is selected The commands used for this operation are STIN STGI and STGR Call Control by SIM The call control mechanism allows the SIM to check all dialed numbers supplementary service control strings and USSD strings b
223. intained ahead of precedence classes 2 amp 3 2 Normal priority Service commitments shall be maintained ahead of precedence class 3 3 Low priority Service commitments shall be maintained after precedence classes 1 and 2 delay Numeric parameter that specifies the delay class 0 Subscribed 1 Delay class 1 2 Delay class 2 3 Delay class 3 4 Delay class 4 Delay maximum values Delay Class SDU size 128 bytes SDU size 1024 bytes Mean Transfer Delay sec 95 percentile Delay Mean Transfer Delay 95 percentile Delay sec sec 0 Subscribed by the Nwk r default if value is omitted 1 Predictive lt 05 2 f 5 Predciv E 3 Predictive 50 250 75 4 Best Effort Unspecified lt reliabiliy gt 0 Subscribed Up to 1 000 8 kbit s Up to 2 000 16 kbit s Up to 4 000 32kbit s Up to 8 000 64 kbit s Up to 16 000 188 kbit s Up to 32 000 256 kbit s Up to 64 000 512 kbit s Up to 128 000 1 024 kbit s Up to 256 000 2 048 kbit s OCOONOOARRWN Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 151 Chapter 15 GPRS Commands Reliability Class GTP Mode LLC Frame Mode LLC Data Protection RLC Block Mode Traffic Type 0 Subscribed Subscribed by the Nwk default if value is omitted 1 Acknowledged Acknowledged Protected Acknowledged Non real time traffic error sensiti
224. iption This command sets the different mailbox numbers in SIM The CPHS command can be used to know which mailbox numbers can be updated Values lt Lineld gt 1 Line1 2 Line2 3 Data lt number gt Phone number in ASCII format lt type gt TON NPI Type of address byte in integer format lt name gt name of mailbox Notes e For the lt name gt parameter all strings starting with 80 81 or 82 are considered in UCS2 format See the Appendix G Coding of Alpha Fields in the SIM for UCS2 If a wrong UCS2 format is entered the string is considered as an ASCII string e The AT command WPCS affects the format of the Mailbox lt name gt entry status When checked with AT CPHS 2 2 it indicates if the number can be updated or not 0 Update is not possible 1 Update is possible Syntax Command syntax AT WMBN lt Lineld gt lt number gt lt type gt lt name gt Response syntax to AT CPHS 2 2 WMBN lt Lineld gt lt number gt lt type gt lt name gt lt status gt Command Possible responses AT WMBN OK AT WMBN OK AT CPHS 2 2 WMBN 1 0123456789 129 Maison 1 Note Get the current Mail Box Numbers in SIM WMBN 2 9876543210 129 Travail 1 WMBN 3 1 WMBN 4 1 OK AT WMBN 1 33122334455 145 OK Note Set mailbox number for line Note Mailbox number for Line 1 is set AT WMBN 2 OK Note Erase mailbox number amp name for line 2 AT CPHS 2 2 WMBN 1 33122334455 145 1 N
225. is used to activate deactivate or interrogate a CPHS feature e g Voice Mail Indicator Mail Box Number Note This command may answer CME ERROR 3 if the CPHS feature is disabled or if the SIM card does not support this CPHS feature lt mode gt 0 Deactivate a CPHS feature 1 Activate a CPHS feature 2 Interrogate a CPHS status Note The deactivate or activate command has no effect on Alternate Line Service Network Operator Name CPHS Information and Customer Profile Service features lt fctld gt 1 Voice Mail Indicator Mail Box Number Alternate Line Service Diverted Call Indicator Network Operator Name CPHS Information Customer Service Profile Note The Customer Profile Service and Alternate Line Service features are activated if the field is set in CPHS Information and CSP files The Network Operator is activated if at least one of the two format names exist Long or Short format This is done in initialization precision Used only if lt mode gt 2 and lt fctld gt 5 to 7 if lt fctld gt 5 this field is type format See WNON if lt fctld gt 6 this field is date field gt See WCPI if lt fctld gt 7 this field is service See WCSP Status 0 CPHS feature disabled 1 CPHS feature enabled Command syntax AT CPHS lt Mode gt lt Fctld gt lt precision gt NOOR WD Command Possible responses AT CPHS lt Mode gt lt Fctld gt OK precision AT CPHS lt Mode gt lt Fctld gt
226. ith this SIM card Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 43 Chapter 7 Security Commands Change Password CPWD Description This command changes a password PIN call barring NCK etc The facility values lt fac gt are the same as for the CLCK command with a P2 facility to manage SIM PIN2 For the network lock PN unlocking is forbidden after 10 failed attempts to disable unlock the network lock with an incorrect password Values lt fac gt supported facilities PS SIM lock facility with an 8 digit password SC PIN enabled lt mode gt 1 disabled mode 0 AQ BAOC Barr All Outgoing Calls Ol BOIC Barr Outgoing International Calls OX BOIC exHC Barr Outgoing International Calls except to Home Country Al BAIC Barr All Incoming Calls IR BIC Roam Barr Inc When Roaming outside Home Country AB All Barring services AG All outGoing barring services AC All inComing barring services P2 FD SIM Fixed Dialing Numbers FDN memory feature PIN2 is required as lt password gt NP Un pr o lt oldpwd gt lt newpwd gt 4 or up to 8 or 16 digits according to the facility Syntax AT CPWD fac lt oldpwd gt lt newpwd gt Command Possible responses AT CPWD CPWD PS 8 SC 8 AO 4 Ol 4 OX 4 Note
227. ivation of PDP context at init not activated 8 PDP contexts and automatic reactivation only for cid 1 PPP silent mode activated GPRS class is 8 GPRS slow connect activated PPP filtering activated Automatic re attachment and PDP reactivation at operator board area WGPRS WGPRS 1 0 WGPRS WGPRS WGPRS WGPRS 2 1 1 2 0 2 2 0 3 2 0 4 WGPRS WGPRS WGPRS WGPRS WGPRS 3 1 4 8 5 1 6 1 7 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 169 Chapter 15 GPRS Commands Examples of Full GPRS AT Commands Activation of an IP PDP Context Example 1 AT CGDCONT 1 IP internet GCDCONT z2 IP abc com OK ATD 99 1 CONNECT Example 2 AT CGCLASS CG OK CGREG 1 AT CGDCONT 1 IP internet OK AT CGQREQ 1 1 4 5 2 14 AT CGQMIN 1 1 4 5 2 14 OK AT CGATT 1 OK AT CGACT 1 1 OK Remark about CGDATA the goal of this command is the same as ATD 99 AT CGDATA 1 CONNECT Data transfer CGEV NW DETACH Network Request AT CGAUTO 0 OK CRING GPRS IP 211 45 89 152 AT CGANS 1 CONNECT n Data transfer Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 170 Chapter 16 Other AT Commands Chapter 16 Other AT Commands V 25ter Recommendation The commands not listed in this document are not supported For these commands the pro
228. iven by STIN Step 4 The customer application uses the STGR SIM Toolkit Give Response to send its response if any to the SIM Toolkit Application The STCR SIM Toolkit Control response indication is an unsolicited result sent by the SIM when Call control functionality is activated and before the customer application has performed any outgoing call SMS SS or USSD Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 139 Chapter 14 SIM Toolkit SIM Toolkit Commands SIM Toolkit Set Facilities STSF Description This command allows SIM Toolkit facilities to be activated deactivated or configured Values lt mode gt 0 Deactivates the SIM Toolkit functionalities 1 Activates the SIM Toolkit functionalities 2 Configures the SIM Toolkit functionalities lt Config gt 160060C01F 5FFFFFFF7F hex format Default 1F6BFFFF1F lt Timeout gt 1 255 Timeout for user responses multiple of 10 seconds Default 3 lt Autoresponse gt 0 Automatic response is not activated 1 Automatic response is activated Default 1 Notes about Values e The activation or deactivation of the SIM Toolkit functionalities requires the use of the CFUN Set phone functionality command to reset the product this operation is not necessary if PIN is not entered yet e The Config parameter gives the coding of the TERMINAL PROFILE precisely the list of SIM Application Toolkit facilities that are s
229. k FREE ERI OE NSn a Auta Aid Ra MARE IAN UAM a Ea RARE 89 Unstructured Supplementary Service Date QUSE iius kl is nat PR ER RRCE eI nara RE ELRE SERA rk AL REC KK E 2 RA BERACER AE ER RA EE 90 Giased Leer ETDUE E E M E sensmafkn ck tup M Praia Fer ECHERRENE P bns vr reer tveerr eam rrry E A A wererretes err errr reer re errr reer tren 91 Chapter 11 Data Commands aiii eckietieicyseismicnieincsavierreattimtnwiauiors UR FIDA GREEN ETUR AR ADI DR UU FAI NAM USKT BM FAR UE RANEIO 92 Using AT Commands During a Data Comme coli see iseseres eter toam eR ht PERRA Stn oidini ti Ath RENEA PAIR ATENEA iie 92 Bearer pe Selecion E BOT uico nadice niii eode p en onn dgidk o dai cde Cue od OE ERR LIE rb aeui e Ie UI eA a 93 Cl CR ura AFLA GO naa iganen inisidan ae 94 Savice Roporing Control aOR tpe 94 Gellar Result Codes MRG asn ar OAT E A R N 95 DTE DGE Local Rate Reporting R Ri cnsinicicnienacneincienancumismnelinnmnmsanonminnnienme nuns 95 Radio Link Protocol Parameters CAP orinroniioranian riit an aaenadsennesunees 96 Other Radio Link Paramotor DOP Ts scie aao peh Kn xn Sd ERA iaiki kbi ai aia a Kad LIA EA or ei ER 96 Splsct ata COMPIE SION SeQ custodis Dalvbdta dam ALI RECUPERA Ern i Kd aA a a A UA 97 Vaas Data Compresso PD ETT TIO C AE A ra SE 97 Wiabis Data Compression Repon DEus case pviinceastesucsssieerdesstes sreseinsas EB ERR USE RRHE LO a Eo rinii ri Eaei 98 Select Dala Erai Corkocno Modo Miu ies asi scd odtazen obici ira aeae eaea aa guine been ia N
230. kA EA RR 13 Request Revision Idendfticauon QGNMIEL uie iaicisiki rera ERREEERA FEE e EIER EIER ECRIRE RAE EXER REI MES RARO ALB A Ra REA 13 aaee e Ser e re e OLIN cars AI dtd AGES EUR A A MARI e etait ANA acacia EA 14 Selle Chago Sel 4 c cc 14 Phonebook character Ser PCTS T T 14 Renie SEU aa MI rer 15 rid cupiens Er Em 15 ure HIIQELOMESC 7o meet 15 aimer enr P 15 Power 9k ce s Me n TA E N 16 Sel Phone Fanctionalty CFUN Nem nran e E RAN 16 Phono Activity Statis JPN ics RU TRA LA EPILA nT EE N ERE ERR hika kai En Ainaa niaii 17 Report Mobile Equipment Emors OME E uiia ddr ci n rara Ek xk kRt ARP gR AER pER a AREE XXE aeiae eeii kiaina 17 Kaypa CODE SECURE EU noui ELI Cni EUER LONGER OAM EAM ERR ELEM CUR LERRA ERU GR ALERTA UAE Kd d E NON x PR t EK RR 17 Glock Management AOUR PEDI mM 18 Alam Management FOCALA e uad qae de EH AFER PEST A E EEA A 18 Chapter 5 Cal Control COmMNMa MaS acan a A a a a 19 EC Onin ae D wr s 19 Hang Up Commana Hasina AN 20 Awara Call Anra a P 21 Bpod enc enra E EEE EEE AE 21 Extended Etter REDOT OER sriid Ra RARE ES Ra RI A Ta Ka OEE arkai aiak 21 a Beets e E a E ig oe T A TEE EEA Tee A TON OOIE TEE EOT A E IT SE 21 Redislbssr Telephone Number DL uso ade Pra eet dpa a eed a A M ibat bab eundi r iG Gba bn NE 22 P tert Dialing wim DIR SoD C 23 Automa Anewa SO er A S AE SE 23 comma cal Bearer FOICE e T
231. lection 9E XX response code for SIM data download error User choice Set by product to 1 Set by product to 1 User choice Set by product to 1 T Timer expiration Set by product to 0 USSD string data object supported in User choice Call Control RFU bit 0 Second byte Other b8 b7 b6 b5 b4 b3 b2 bi Command result User choice Call Control by SIM User choice Cell identity included in Call Control User choice by SIM MO short message control by SIM User choice Handling of the alpha identifier User choice according to subclause 9 1 3 UCS2 Entry supported User choice UCS2 Display supported User choice Display of the extension text User choice Third byte Proactive SIM b8 b7 b6 b5 b4 b3 b2 bi Proactive SIM DISPLAY TEXT User choice Proactive SIM GET INKEY User choice Proactive SIM GET INPUT User choice Proactive SIM MORE TIME User choice Proactive SIM PLAY TONE User choice Proactive SIM POLL INTERVAL Set by product to 1 Proactive SIM POLLING OFF Set by product to 1 Proactive SIM REFRESH User choice Fourth byte Proactive SIM b8 b7 b6 b5 b4 b3 b2 bi Proactive SIM SELECT ITEM User choice Proactive SIM SEND SHORT User choice MESSAGE Proactive SIM SEND SS User choice Proactive SIM SEND USSD User choice Proactive SIM SET UP CALL User choice Proactive SIM SET UP MENU User choice Proactive SIM PROVIDE LOCAL Set by product to 1 INFORMATION MCC MNC LAC Cell ID amp IMEI Proactive SIM PROVIDE LOCAL Set by product
232. lowed range is 0 31 Default 10 PcmThMax Specifies threshold of max energy information The allowed range is 0 31 Default 7 e Echo Cancellation 6 12 parameters AlgoParam High value leads to high echo attenuation but the full duplex quality will be less efficient The allowed range is 0 63 30 by default lt NoiseThres gt indicates the noise threshold Low value leads to high noise attenuation The threshold 32767 indicates no noise attenuation The allowed range is 0 32767 The default is 50 The values above 512 have no effect noise reduction will be disabled lt NmbTaps gt indicates the Number of Taps of the Adaptive Filter The allowed range is 2 256 The default is 256 64 taps short Echo 256 taps long Echo Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 27 Chapter 5 Call Control Commands lt ConvergenceTime1 gt Convergence time in quiet condition This parameter expresses duration as the number of GSM speech frames 20 ms each containing far end speech upon which the switch only mechanism must run in quiet conditions The allowed range is 162 32767 The default is 200 lt ConvergenceTime2 gt Convergence time in noise condition This parameter is the same as ConvergenceTime1 but for the noise condition The allowed range is 162 32767 The default is 550 Important Note ConvergenceTime2 must be greater than
233. ls are available Else CLCC lt id1 gt lt dir gt lt stat gt lt mode gt lt mpty gt lt number gt lt type gt lt alpha gt lt CR gt lt LF gt CLCC lt id2 gt lt dir gt lt stat gt lt mode gt lt mpty gt lt number gt lt type gt lt alpha gt lt CR gt lt LF gt OK Command Possible responses RING Note Incoming call AT CLCC CLCC 1 1 4 0 0 0146294079 129 OK ATA OK Note Answering the call AT CLCC CLCC 1 1 1 0 0 0146294079 129 OK ATD0146299704 OK Note Outgoing Call AT CLCC CLCC 1 0 2 0 0 0146294079 129 Note Before the phone called is ringing OK AT CLCC CLCC 1 0 3 0 0 0146294079 129 Note The phone called is ringing OK AT CLCC CLCC 1 0 0 0 0 0146294079 129 Note The call is being answered OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 88 Chapter 10 Supplementary Services Commands Supplementary Service Notifications CSSN Description Values Syntax This command refers to supplementary service related network initiated notifications n Parameter sets shows the CSSI result code presentation status 0 disable 1 enable lt m gt Parameter sets shows the CSSU result code presentation status 0 disable 1 enable code1 0 unconditional call forwarding is active 1 some of the conditional call forwardings are active 4 closed User Group call with CUG index 5 ou
234. mber lt num_Data gt Data phone number lt Email gt E Mail address lt Address gt Postal address lt Phb_Group gt Phonebook group The structure including lt num_Mobile gt lt num_Work gt lt num_Data gt lt Email gt and lt Address gt will be represented by lt Contact gt in the rest of the document Phonebook Groups Parameter Definition lt index gt Group index lt name gt Group name lt phb_entry_index gt Phonebook entry index lt restrict call gt Restrict call mode for incoming calls Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 45 Chapter 8 Phonebook Commands Select Phonebook Memory Storage CPBS Description This command selects phonebook memory storage Note on ADN and FDN activation When FDN has been activated with the CLCK command the selection of ADN phonebook is possible only if ADN staus bit3 is set to 1 EF file is readable and can be updated when invalidated Please refer to Recommendation 3GPP 11 11 for more details Note The previously selected phonebook remains the same when the modem is switched on or reset even if the new SIM card is inserted However in the case when the replacemnet SIM card does not contain any slected phonebook the ADN phonebook is selected Values lt pb gt Phonebook SM ADN Abbreviated Dialing Numbers SIM phonebook FD FDN Fixed Dialing Numbers SIM restricted phonebook ON MSISDN SIM
235. message SMS CB CBM bytes in PDU mode AT CSCB 1 OK Note Deactivate the reception of CBMs Note CBM reception is completely stopped Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 74 Chapter 9 Short Messages Commands Cell Broadcast Message Identifiers WCBM Description Values Syntax This specific command is used to read the EF CBMI SIM file The EF CBMI file is not used with the CSCB command The application should read this file using AT WCBM and combine the Message Identifiers with those required by the application lt mids gt message identifiers Command Syntax AT WCBM lt mids gt Command Possible responses AT WCBM 10 100 1000 10000 OK Note Write 4 messages identifiers in EFCBMI Note CBMls are stored in EF CBMI AT WCBM WCBM 10 100 1000 100000 Note Read the CBMIs in EF CBMI OK Note 4 CBMls are stored in EF CBMI Message Status Modification WMSC Description Values Syntax Note This command allows the manipulation of a message status The accepted status changes are from READ to NOT READ and vice versa and also from SENT to NOT SENT and vice versa lt loc gt Location number of the stored message lt interger gt lt status gt New status to be stored as in the CMGL command PDU Mode Text Mode 0 REC UNREAD 1 REC READ 2 STO UNSENT 3 STO SENT
236. mode gt 2 0 Duration of pulse is 5 us 1 31 Duration of pulse is n x 30 us Important Pulse duration may be increased by up to 3 ms due to interrupt processes overhead Note Remind that this mode corresponds to the case where the remote equipment has dropped its RTS signal to stop its flow control Syntax Command syntax AT WRIM lt n gt Command Possible responses AT WRIM 0 OK Note Select up down RI mode Note up down RI mode selected AT WRIM 1 OK Note Select pulse RI mode Note pulse RI mode selected AT WRIM 2 0 OK Note Select mode pulse RI on downloaded packet pluse duration is 5 us Note mode pulse RI Pulse on downloaded packet selected AT WRIM Note Ask the list of possible values WRIM 0 2 0 33 OK Note possible values 0 1 or 2 AT WRIM Note Ask the current value WRIM 1 OK Note current RI mode is pulse RI Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 122 Chapter 13 Specific AT Commands 32kHz Power Down Mode W32K Description This command allows the 32kHz power down mode to be enabled or disabled e When power down mode is entered the product uses a 32kHz internal clock during inactivity stages regardless of its nominal internal clock e When enabled power down mode is active after 1 to 15 minutes The mode is not stored in EEPROM the command has to be repeated after a reset For additional information on power down mode
237. mp C lt n gt Command Possible responses AT amp CO OK Note DCD always on Note Command valid AT amp C1 OK Note DCD matches state of the remote Note Command valid modem s data carrier Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 101 Chapter 12 V 24 and V 25 Commands Set DTR Signal amp D Description This commands controls the Data Terminal Ready DTR signal Values lt n gt 0 The DTR signal is ignored 1 Modem switches from data to command mode when DTR switches from ON to OFF 2 Upon DTR switch from ON to OFF the call is released Syntax Command syntax AT amp D lt n gt Command Possible responses AT amp DO OK Note The DTR signal is ignored Note Command valid AT amp D1 OK Note Modem switches from data to command mode when DTR switches from ON to OFF Note Command valid AT amp D2 Note Upon DTR switch from ON to OFF the call is released OK Note Command valid Set DSR Signal amp S Description This commands controls the Data Set Ready DSR signal Values lt n gt 0 DSR always on 1 DSR off in command mode DSR on in data mode Syntax Command syntax AT amp S lt n gt Command Possible responses AT amp SO OK Note DSR always on Note Command valid AT amp S1 OK Note DSR off in command mode DSR on in data mode Note Command valid Back to Online Mode O Description If a connection has been
238. n gt 0 no compression default 2 V42bis compression if supported Command syntax AT C lt n gt Command Possible responses AT CO OK Note Command Note Feature supported AT C2 OK Note Command Note V42bis supported AT C 2 Note Current value OK Note Command valid V42bis Data Compression DS This command enables or disables V 42bis data compression if this feature is supported on the product Note that the product allows only the MNP2 protocol Description Values Syntax lt dir gt lt neg gt lt P1 gt lt P2 gt Specifies the desired direction s of operation of the data compression function from the DTE point of view default is 3 0 Negotiated no compression 1 Transmit only 2 Receive only 3 Both directions accept any direction Default Specifies whether or not the DCE should continue to operate if the desired result is not obtained default is O 0 Do not disconnect if V 42 bis is not negotiated by the remote DCE as specified in lt dir gt Default 1 Disconnect if V 42 bis is not negotiated by the remote DCE as specified in lt dir gt Specifies the maximum number of dictionary entries that should be negotiated Range is 512 to 2048 Default is 2048 Specifies the maximum string length to be negotiated Range is 6 to 250 Default is 20 Command syntax AT DS I lt dir gt lt neg gt lt P1 gt lt P2 gt Command Possible responses AT DS DS
239. n the SO n n gt 0 command is received the modem attempt to perform a GPRS attach if it is not already attached Failure will result in ERROR being returned to the DTE Subsequently the modem will announce a network request for PDP context activation by issuing the unsolicited result code RING to the DTE followed by the intermediate result code CONNECT The modem then enters V 25ter online data state and follows the same procedure as it would after having received a CGANS 1 with no lt L2P gt or cid values specified Note The S0 n n 0 command does not perform an automatic GPRS detach Manual Acceptance of a Network Request for PDP Aontext Activation A The V 25ter A Answer command may be used to accept a network request for a PDP context activation announced by the unsolicited result code RING The modem responds with CONNECT enters V 25ter online data state and follows the same procedure as it would after having received a CGANS 1 with no cid value specified It is an error to issue the A command when there is no outstanding network request Manual Rrejection of a Network Request for PDP Context Activation H The V 25ter H or HO On hook command may be used to reject a network request for PDP context activation announced by the unsolicited result code RING The modem responds with OK It is an error to issue the H command when there is no outstanding network request Note This is an extension to the usage of the H
240. n the SIM for UCS2 The coding can take one of the three following structures If the ME supports UCS2 coding of alpha fields in the SIM the ME shall support all three coding schemes for character sets containing 128 characters or less for character sets containing more than 128 characters the ME shall at least support the first coding scheme If the alpha field record contains GSM default alphabet characters only then none of these schemes shall be used in that record Within a record only one coding scheme either GSM default alphabet or one of the three described below shall be used 1 Ifthe first byte in the alpha string is 0x80 then the other bytes are 16 bit UCS2 characters The more significant byte MSB of the UCS2 character is coded in the lower numbered byte of the alpha field and the less significant byte LSB of the UCS2 character is coded in the higher numbered alpha field byte In other words byte 2 of the alpha field contains the more significant byte MSB of the first UCS2 character and byte 3 of the alpha field contains the less significant byte LSB of the first UCS2 character as shown below Unused bytes shall be set to FF and if the alpha field has an even number of bytes then the last unusable byte shall be set to FF Example 1 80 Ch wss Ch iss Ch2uss Chaise Ch3wss Chaise FF FF 2 Ifthe first byte of the alpha string is set to 0x 81 then the second byte contains a value in
241. name of the PLMN lt long name gt The long name of the PLMN Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 33 Chapter 6 Network Service Commands Syntax Command Syntax AT WOLM lt mode gt lt loc gt lt NumOper gt lt short name gt lt long name gt Response Syntax for AT WOLM OK Response Syntax for AT WOLM lists all the available PLMN Command Possible responses AT WOLM 1 1 20812 WM WM PLMN Note Add a new PLMN at location 1 OK AT4 WOLM 2 1 Note Read the PLMN at location 1 WOLM 1 20812 WM WM PLMN OK AT4 WOLM 2 1 1 Note Read the PLMN at location 11 CME ERROR 21 Note Invalid index AT WOLM 1 1 20812 WM1 WM1 PLMN OK Note Modify and existing PLMN Done AT WOLM OK Note Test command AT WOLM WOLM 1 20812 WM1 WM1 PLMN Note Display current list OK Note List the created PLMN in flash AT WOLM 1 20813 PLMN2 PLMN2 LONG OK Note Add a new PLMN at available location Or CME ERROR 20 Note Error returns if no more PLMN can be created AT WOLMS 0 1 Note Delete an entry at location 1 OK AT WOLMS 0 11 Note Delete an entry at location 11 CME ERROR 21 Note Invalid index Read Operator Name WOPN Description This command returns the operator name in alphanumeric format when given the numeric format being given With the E ONS Enhanced Operator N
242. nce Intermediate AT CCED WIND 3 N N AT WIND WIND 3 N N AT ADC WIND 3 N N AT CMER WIND 3 N N AT WLPR WIND 1 N N AT WLPW WIND 3 N N AT WIOR WIND 1 N N AT WIOW WIND 1 N N AT WIOM WIND 3 N N AT WAC WIND 3 N N AT WTONE WIND 3 N N AT WDTMF WIND 3 N N AT WDWL WIND 3 N N AT WVR WIND 3 N N AT WDR WIND 3 N N AT WSVG WIND 3 N N AT WSTR WIND 3 N N AT WSCAN WIND 3 N N AT WRIM WIND 3 N N AT W32K WIND 3 N N AT WCDM WIND 3 N N AT WCCS WIND 4 N N AT WLCK None PIN for auto CNL N Y for auto CNL N AT CPHS WIND 4 Y N AT WMIR WIND 3 N N AT WCDP WIND 3 N N AT WMBN PIN Y N AT WALS WIND 4 AT WOPEN WIND 3 N N AT WRST WIND 3 N N AT WSST WIND 3 N N AT WATH WIND 3 N N AT WMBS WIND 3 N N SIM Toolkit Commands AT commands Conditions SIM dependence Intermediate AT STSF None N N AT STIN WIND 4 Y N AT STGI WIND 4 Y N AT STGR WIND 4 Y N Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 196 Appendix G Conditions for Command Execution and SIM Dependence GPRS Commands AT commands Conditions SIM dependence Intermediate AT CGDCONT WIND AT CGQREQ__ WIND AT CGQMIN WIND AT CGATT WIND AT CGACT WIND AT CGDATA _ WIND WS H H H H R HR HJO H A AIBRI AIR AT CGCLASS WIND N N AT CGCLASS WIND AT CGSMS WIN
243. ncoming bearer is given see CSNS Note Setting the CICB command affects the current value of CSNS Values lt mode gt 0 Data 2 Speech Syntax AT CICB lt mode gt Command Possible responses AT CICB 2 OK Note If no incoming bearer force a voice call Note Command accepted AT CICB CICB 2 Note Interrogate value OK Note Default incoming bearer voice call AT CICB CICB 0 2 Note Test command OK Note Speech or data default incoming bearer Single Numbering Scheme CSNS Description Selects the bearer to be used when an modem single numbering scheme call is set up see CICB Note Setting the CSNS command affects the current value of CICB Values mode 0 Voice 4 Data Syntax AT CSNS Command Possible responses AT CSNS 0 _ Note force a voice call OK Note Command accepted AT CSNS Note Interrogate value CSNS 0 Note Default incoming bearer voice call AT CSNS Note Test command CSNS 0 2 4 Note Voice or data default incoming bearer Gain Control VGR VGT Description This command is used by the application to tune the receive gain of the speaker and the transmit gain of the microphone Values lt Rgain gt is the reception gain lt Tgain gt is the transmission gain Syntax AT VGR lt Rgain gt and AT VGT lt Tgain gt Command Possible responses AT VGR 25 OK Note Command valid AT VGT 45 OK Note Command valid AT VGR VGR 128 Note Int
244. ncy in absolute format lt rssi gt 0 113 dBm or less 1 111 dBm 2 30 109 to 53 dBm 31 51dBm or greater 99 not known or not detectable Syntax Command syntax AT WSCAN lt absolute frequency Response syntax WSCAN lt rssi gt Command Possible responses AT WSCAN 50 WSCAN 23 OK Note Request lt rssi gt of absolute frequency 50 Note lt rssi gt is 23 AT WSCAN 1025 CME ERROR 3 Note Request power of absolute frequency 1025 Note 1025 is not a valid absolute frequency Ring Indicator Mode WRIM Description This command sets or returns the state of the Ring Indicator Mode e In up down RI mode no pulses are sent before unsolicited AT response and up down signals are sent when receiving an incoming call e In pulse RI mode an electrical pulse is sent on the Ring Indicator signal just before sending any unsolicited AT response in order not to lose AT responses when client tasks are in sleep state Still in RI mode when receiving incoming calls electrical pulses are sent on the RI signal e Pulse RI Mode Pulse On Packet Downloaded based on Pulse RI mode but an electrical pulse is also sent on the Ring Indicator signal just before sending a downloaded data packet GPRS or CSD if the remote client has dropped down his RTS signal Values mode 0 Up down RI mode 1 Pulse RI mode 2 Pulse RI mode Pulse on Downloaded Packet n used only in mode RI Pulse Pulse on Downloaded Packet lt
245. ndicator for Line 1 Note Call Forward is active for Line 1 AT CPHS 2 6 22 WCPI 22 0 Note Get current status for Line 2 Mailbox Number OK Note Mailbox Number for Line 2 is not available AT CPHS 2 6 17 CME ERROR 3 Note Wrong data field AT CPHS 2 6 22 CME ERROR 3 Note Get current status for Line 2 Mailbox Number Note CPHS feature is not allowed AT CPHS 0 6 OK Note Deactivatation of CPHS Information feature Note No effect Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 129 Chapter 13 Specific AT Commands Customer Service Profile WCSP Description Values Syntax This indication tells whether or not a service is accessible to the customer This command is the response to the AT CPHS 2 7 lt service gt command lt service gt value indicating the CSP field to display See Codes and Values in the Appendix status 0 service is not customer accessible 1 service is customer accessible Note The field Alternate Line Service CPHS Teleservices Group sets the ALS feature at initialization Command Syntax AT CHPS 2 7 lt service gt Response Syntax WCSP lt service gt lt status gt Command Possible responses AT WCSP ERROR AT WCSP ERROR AT CPHS 2 7 CME ERROR 3 Note Syntax error AT CPHS 2 7 9 WCSP 9 1 Note Get current status of Barring All Outgoing Calls OK Note Barring or All Outgoing Calls is customer accessible
246. nfigured for outgoing and incoming calls Note According to the modem s capabilities the following voice coding type are allowed e Modem that supports AMR FR EFR AMR FR AMR HR are supported e Modem that does not support AMR FR EFR HR are supported Values Voice coding type Voice Coding Preferred Other Supported Types Default Values Type Type 0 FR Default incoming voice calls rate 1 EFR FR 2 HR FR 3 FR HR 4 HR EFR 5 EFR HR FR Default outgoing voice calls rate 6 AMR FR EFR AMR HR FR 7 AMR FR EFR AMR HR HR FR 8 AMR HR_ HR AMR FR EFR FR 9 AMR HR AMR FR EFR FR 10 AMR HR AMR FR FR 11 AMR HR HR AMR FR FR 12 AMR FR AMR HR FR 13 AMR FR FR AMR HR 14 AMR FR FR AMR HR HR 15 EFR FR HR Command syntax AT WVR AT WVR AT WVR out coding type in coding type out coding type in coding type WDR out coding type in coding type OK Note out coding type is related to outgoing calls in coding type to incoming calls Command Possible responses AT WVR 1 OK Note Configure voice type FR and EFR for outgoing calls only Note Bearer is configured for outgoing calls AT WVR 1 4 Note Configure voice type FR and EFR for outgoing calls and HR and EFR for incoming calls OK Note Bearer is configured for outgoing calls and incoming calls AT WVR2 4 Note Configure voice type HR and EFR for incoming calls OK Note Bearer is unc
247. nglish 2 Italian 3 French 4 Spanish 5 Dutch 6 Swedish 7 Danish 8 Portuguese 9 Finnish 10 Norwegian 11 Greek 12 Turkish 13 Hungarian 14 Polish 32 Czech 33 Hebrew 34 Arabic 35 Russian 36 Icelandic Syntax Command syntax AT WLPR index gt Response syntax WLPR value Command Possible responses AT WLPR WLPR 4 Note Read command OK Note Four language preferences are available in EF LP AT WLPR 1 WLPR 5 Note Read first EF LP index value OK Note Language preference is 5 Write Language Preference WLPW Description Write a Language Preference value in EF LP Values lt index gt Offset in the available languages range SIM dependent lt value gt See lt values gt examples above Read Language Preference WLPR Syntax Command syntax AT WLPW lt index gt lt value gt Response syntax OK or CME ERROR lt err gt Command Possible responses AT WLPW 1 5 OK Note Write Lang Pref equal to 5 in EF LP with index 1 Note EF LP correctly updated Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 113 Chapter 13 Specific AT Commands Read GPIO Value WIOR Description Read the requested GPI or GPIO pin value Notes e By default e g after a reset the I O ports configuration is set by the WIOM command e This command is allowed only on a GPIO not allocated by an Open AT embedded application or for bus operations e Wh
248. nute remain before next reset Set Standard Tone WSST Description This command sets and gets the sound level of the Standard Tones Values lt sound level gt Range 0 15 0 Maximum volume default 15 Minimum volume ring tone level Range 0 15 0 Maximum volume default 15 Minimum volume Syntax Command syntax AT WSST lt sound level gt lt ring tone level gt Command Possible responses AT WSST 0 OK Note Set volume to Maximum AT WSST 15 OK Note Set volume to Minimum AT WSST 5 OK Note Set ring tone level to 5 AT WSST WSST 15 5 Note get current standard tones OK sound level Note current standard tones level is 15 minimum and ring tone level is 5 AT WSST WSST 0 15 0 15 Note supported parameters OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 135 Chapter 13 Specific AT Commands Hang up WATH Description This command disconnects the remote user specifying a release cause and the location In the case of multiple calls all calls are released active on hold and waiting calls Values lt RelCause gt decimal value from 1 to 127 See table Failure Cause from GSM 04 08 recommendation lt location gt optional parameter default value 0 values as defined in 04 08 0 user private network serving the local user public network serving the local user transit network public network serving the remote user priv
249. o FRE i de bee dim mud S ri aig og ciun 60 Select Message Sevice 4OSMS M 61 New Message Acknowledgement AONIMM i iiis teaesu cut acid bars etu drad a tke err penea cota deai 61 I cago Message Ecneq h MACIGILUT cM 63 Prioirsd Mossage OMe WS c t M 64 RAVE CUMS ESA D H 65 PIS SOS Senno elc M 65 Show Texr Mode Palsimelele QS DE seii exe kA bak akanai out a KATHERINE EUR EA ekki I ERN Gd Ka RE 65 New Message Indi ste TUE irinin eiii eiieeii ka terrae a LER ELDER aae EU 66 cie ccce Me E TNI HR 68 Lo tipecags LIE aia iecit ade c MA rer retreree eres ATKCELAM E MAE PE AE a DUE rrr yt MA SEXUEL E E TN 69 cH LC Were zo E a 70 Werite Message te Memory I cM TETTE 71 mend Message from Storage COMBS LM 72 Ser Text Mods Paramelers GONE Ariranha aiaa aaea 72 Belate Message WI It Poeec adie nae eae ebb eae miaete 73 Seke Center Address EP qoom 74 Select Gell Broadcast Message Types CSOB inesi oirein mn EO NR 74 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 4 Table of Contents Gell Broadcast Message Identifiers WOBM in sitiisisiciirsnsisiisiinsniinanaininiiin iania iniaiaiai k iiaiai an tia 75 Message Status Modification XVIIIe iet poa b tra ban EETN tisavo acauceascosdaesansacerserajadbea EA EATE EE 75 Message Overwniting TYGE sinea rE S EAA 76 Change or Do Not Change
250. ode 1900 MHz dual band mode 850 1900 MHz dual band mode 900E extended 1800 MHz dual band mode 900E extended 1900 MHz indicates the type of change the modem will have to be reset in order to start on the specified band s lt ResetFlag gt is set to 1 the change is effective immediately The GSM stack is restarted with the specified band s lt ResetFlag gt stays at 0 This mode is forbidden whil in communication and during modem initialization If lt Param gt is not given the modem has to be reset to start on the specified band s as for lt param gt 0 lt ResetFlag gt 0 1 the feature was not modified since the last boot of the product the feature has been modified since the last boot of the product it has to be reset in order to take the modification into account This is the case when the band was changed with AT WMBS lt band gt or AT WMBS lt band gt 0 Command Syntax AT WMBS lt Band gt lt param gt Response Syntax WMBS lt Band gt lt ResetFlag gt Command Possible responses AT WMBS lt Band gt OK Note The modem has to reset for the change to be effective AT WMBS lt Band gt 0 OK Note The modem has to reset for the change to be effective AT WMBS lt Bands gt 1 OK Note Band mode selected and GSM stack restarted AT WMBS lt Band gt CME ERROR 3 Note Band not allowed AT WMBS WMBS lt Band gt lt ResetFlag gt OK Note Current selected band mo
251. ong parameter is entered Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 140 Chapter 14 SIM Toolkit Enable the reporting of mobile equipment errors Set indications Query ME Status ME is ready Test command SIM Toolkit Set Facilities STSF 0 2 160060C01F 5FFFFFFF7F 1 255 Example AT CMEE 1 OK AT WIND 15 OK AT CPAS CPAS 0 OK AT STSF OK AT STSF STSF 0 160060C000 3 OK AT STSF 2 5FFFFFFF7F OK AT STSF 3 CME ERROR 3 AT STSF 1 OK AT CFUN 1 OK AT CPIN CPIN SIM PIN AT CPIN 0000 OK WIND 4 AT STSF STSF 1 5FFFFFFF7F 3 OK No activation of SIM Toolkit functionality Set all SIM Toolkit facilities class 3 Syntax Error Activation of SIM Toolkit functionality Reboot Software Is the ME requiring a password Yes SIM PIN required PIN OK Init phase is complete SIM Toolkit functionality activated with all facilities Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 141 Chapter 14 SIM Toolkit SIM Toolkit Indication STIN or STRIL Unsolicited Result In order to allow the customer application to identify the pro active command sent via SIM Toolkit a mechanism of unsolicited SIM Toolkit indications STIN is implemented Syntax AT STIN lt CmdType gt Option lt CmdType gt 0 Indicates that a Setup Menu pro active command has been sent from the SIM Indicat
252. ontrol Command WOPEN Description Values Syntax This command starts stops deletes and gets information about the current Open AT embedded application This command also allows you to erase the Open AT flash objects storage place and to configure the Application and Data A amp D storage place size Mode 0 Stop the Open AT embedded application If this one was running the product resets 1 Start the Open AT embedded application If this one was stopped the product resets 2 Getthe Open AT library versions 3 Erase the objects flash of Open AT embedded application 4 Erase the Open AT embedded application 5 Suspend in Wavecom software kernel the Open AT embedded application tasks 6 Ifthe A amp Dsize parameter is used configure the Application amp Data storage size Otherwise display the current A amp D storage place size and Open AT application space size If the A amp D storage place size has changed the product resets Notes e For Mode 1 If the main version numbers returned by the AT WOPEN 2 command do not match the command will reply CME ERROR 541 e Mode 3 and 4 are only available only if the Open AT embedded application is stopped AT WOPEN 0 e Open AT embedded applications can be resumed with the AT OPENRES command or INTERRUPT feature see WCFM e Warning With Mode 6 any A amp D size change will lead to this area format process this process will take some seconds on start up before the WIND 3 ind
253. or equal to lt ConvergenceTime1 gt lt NoiseLevelMAX gt Upper bound of the noise floor estimate This parameter is expressed as an integer of 16 bits and corresponds to the rounded value of the noise floor estimate expressed in dB log2 The allowed range is NOISE LEVEL MIN 1 31 with NOISE LEVEL MIN being a constant NOISE LEVEL MIN 4 in the current implementation The default is 15 lt DetectionThreshold gt Far end speech detection threshold In order to detect far end speech on the loudspeaker s signal the SNR is computed regarding the far end signal power and the far end signal noise floor level This parameter specifies a threshold on the SNR above which the switch mechanism will be activated This parameter is expressed as an integer of 16 bits and must be in the range 0 32767 The default is 32767 lt CNGAdjust gt Comfort noise volume gain Although the comfort noise volume will self adjust to the estimated ambient noise level it is possible to artificially reduce its level This parameter is expressed in fixed point as a signed Q15 meaning that 32767 stands for 1 0 and 0 for 0 0 It ranges fro 0 to 32767 Setting this value to 0 means no comfort noise The default is 32767 lt CNGParam1 gt CNGParam2 16 bits comfort noise AR2 coefficients The user will set the AR2 coefficients for a specific car Their value will be estimated on a recorded noise sequence by means of a tool provided by Wavecom C or Matl
254. orwarding is deactivated 1 Call forwarding is activated Note Call forwarding SS is set by the AT CCFC command Command Syntax WDCI lt Lineld gt lt Status gt Response Syntax to AT CPHS WDCI lt Lineld gt lt flag gt Command Possible responses AT CPHS 1 4 OK Note Activate Divert Call Indicator feature AT CPHS 2 4 WDCI 1 1 divert call indicator is active on Line 1 Note Get the current status of Divert Call WDCI 2 1 divert call indicator is active on Line 2 Indicator WDCI 3 0 divert call indicator is deactived on data AT CPHS 2 4 CME ERROR 3 Note CPHS feature is not allowed AT CPHS 1 4 OK Note Activatation of Divert Call Indicator Note Divert Call Indicator feature is activated feature WDCI 1 1 Note Call forwarding is active on Line 1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 Chapter 13 Specific AT Commands Network Operator Name WNON Description Values Syntax This indication provides the name of the network operator as a character string This command is the response to the AT CPHS 2 5 lt type format gt command type format 0 Long format operator name 1 Short format operator name Default operator name The name of the operator in long or short format Command Syntax AT CHPS 2 5 lt type format gt Response Syntax WNON lt type format gt lt operator name gt Command Possibl
255. ote Get current Mail Box Numbers again WMBN 2 1 WMBN 3 1 WMBN 4 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 131 Chapter 13 Specific AT Commands Alternate Line Service WALS Description Values Syntax This command allows you to set and to get the active line The CPHS command can be used to know which line is active CmdType 0 Set active line 1 Get active line lt Lineld gt Used only for lt CmdType gt 1 Line1 2 Line2 Command syntax AT WALS lt CmdType gt lt Lineld gt Response syntax to AT CPHS 2 3 WALS lt Lineld gt Command Possible responses AT WALS WALS 1 OK Note Display current active line AT WALS WALS 0 1 1 2 OK AT WALS 0 1 WALS 1 Note Activate Line 1 OK AT WALS 0 2 CME ERROR 3 Note Activate Line 2 Note When the ALS feature is not allowed AT WALS 1 WALS 1 Note Get the current Active Line AT WALS 1 2 AT CPHS 0 3 Note Deactivation of ALS feature AT CPHS 2 3 Note Interrogate ALS feature Note Display the current Active Line CME ERROR 3 Note Syntax error OK Note No effect WALS 1 Note Display the current Active Line CME ERROR 3 Note In the case where the ALS feature is not allowed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 132 Chapter 13 Specific AT Commands Wavecom Open AT C
256. ou can activate deactivate the echo cancellation during a call without resetting the product if the lt Algold gt parameter is not changed but have to used the syntax with all parameters AT ECHO 1 6 30 8000 256 for instance e To use Echo Cancellation 6 the ECHO feature must be activated e Note that Echo Cancellation algorithms may not be available on some modems Modem Algorithm 6 Support Algorithm 3 Support Q24 Plus AMR Yes No Values lt mode gt 0 Deactivate Echo 1 Activate Echo When mode 1 is choosen Algold is mandatory lt status gt 0 Echo Deactivated 1 Echo Activated for Mic Spk One 2 Echo Activated for Mic Spk Two 3 Resetthe product Note Status does not indicate the currently selected speaker If Echo is activated it indicates the speaker for which Echo parameters are set Echo can be activated on a non selected speaker lt Algold gt 1 Echo cancellation 1 6 Echo cancellation 6 AEC algorithm Note that Echo Cancellation algorithms may not be available on some modems Refer to the description above e Echo Cancellation 1 4 parameters lt Volout gt Specifies the maximum attenuation of the switch 0 31 db default 1 29 db 2 27 db 3 25 db 14 3db 15 1 db Step Specifies the attenuation step between attenuation and no attenuation 0 1 db 1 2 db 2 3 db 3 4 db default lt PcmThRel gt Specifies the relative threshold between max and min energy information The al
257. own numbers EN ECC Emergency Call Codes SIM or Mobile Equipment LD LND Last Number Dial MC Mobile Equipment missed unanswered received calls list ME Mobile Equipment phonebook MT Combined Moblile Equipment and SIM phonebook ME SM RC Mobile Equipment received calls list SN SDN Services Dialing Numbers SIM special service numbers Notes EN will be available even if ECC SIM file is not present When the SIM is not present the following emergency numbers are available 000 08 112 110 118 119 911 999 When the SIM is present the following emergency numbers are available 112 911 emergency number from ECC SIM files if existing lt pin2 gt Personal Identification Number 2 Notes The following emergency numbers are stored in E2P 112 911 999 08 EN will be available even if ECC SIM file is not present Maximum Entries The maximum number of entries for the Mobile Equipment phonebook is 500 Syntax AT CPBS lt pb gt lt pin2 gt Command Possible responses AT CPBS SM OK Note Select ADN phonebook Note ADN phonebook is selected AT CPBS CPBS SM LD MC ON ME RC MT SN EN Note Possible values OK Note only EN phonebook is not supported with this SIM card AT CPBS CPBS SM 10 20 Note Status OK Note ADN phonebook selected 10 locations used 20 locations available Selection of the ADN phonebook when FDN is a
258. per gt Command Possible responses AT COPN COPN 23201 A1 COPN 23203 Amax Note Ask for list of operators COPN 23207 A tele ring COPN 23205 one OK CME ERROR err AT COPN OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 39 Chapter 7 Security Commands Chapter 7 Security Commands Enter PIN CPIN Description This command enters the ME passwords CHV1 CHV2 PUK1 PUK2 etc that are required before any ME functionality can be used CHV1 CHV2 is between 4 and 8 digits long PUK1 PUK2 is only 8 digits long If the user application tries to make an outgoing call before the SIM PIN code CHV1 has been confirmed then the product will refuse the ATD command with a CME ERROR 11 SIM PIN required The application is responsible for checking the PIN after each reset or power on if the PIN was enabled Values pin is the Personal Identification Number A four digit number puk is the Personal Unblocking Key needed to change the PIN An eight digit number Syntax AT CPIN lt pin gt Command Possible responses AT CPIN 1234 OK Note Enter PIN Note PIN code is correct AT CPIN 5678 CME ERROR 3 Note Enter PIN Note Operation not allowed PIN previously entered After 3 unsuccessful attempts to enter the PIN Personal Identification Number the PUK Personal Unblocking Key will be required
259. pplication has been downloaded on this product AT WOPEN 1 CME ERROR 541 Note Since main versions do not match the Open AT Application cannot be started AT WOPEN 2 WOPEN 2 AT v2 00 AT v2 00 Note Get the Open AT library OK versions Note Open AT v2 00 library version An embedded application has been downloaded on this product Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 133 Chapter 13 Specific AT Commands AT WOPEN 3 OK Note The objects flash are erased AT WOPEN 1 OK Note Start the embedded WIND 3 application Note Product reset in order to start the embedded application AT WOPEN 3 CME ERROR 532 Note The embedded application is activated so the objects flash are not erased AT WOPEN 4 CME ERROR 532 Note The embedded application is activated so it cannot be erased AT WOPEN 0 OK Note Stop the embedded WIND 3 application Note Product reset in order to stop the embedded application AT WOPEN 3 OK Note The objects flash are erased AT WOPEN 4 OK Note The embedded application is erased AT WOPENS 6 WOPEN 6 768 832 OK Note 768 Kbytes are reserved for A amp D storage place and 832 for the Open AT Application AT WOPENS6 1280 CME ERROR 550 Note The current Open AT Application size is too big to allow this new A amp D storage place size AT WOPENS6 768 WOPEN 6 768 832 OK Note No product reset same size used AT WOPEN 6 900 WOPEN 6 960 640 OK WIN
260. racter of 2D which is a dash e Byte 6 contains a value 82 which indicates it is an offset of 02 added to the base pointer resulting in a UCS2 character code of 0532 which represents Armenian character Capital BEN e Byte 7 contains a value D3 an offset of 53 which when added to the base pointer results in a UCS2 code point of 0583 representing Armenian Character small PIWR Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 192 Appendix F Command Execution and Dependence on SIM Appendix F Command Execution and Dependence on SIM The following table lists AT command execution syntax and the execution condition The SIM dependency column indicates if the command behavior will vary if another card is used For example it will vary for phonebook reading commands The Intermediate column indicates if intermediate response can occur General Commands AT Commands Conditions SIM dependence Intermediate AT CGMI WIND 3 N N AT CGMM WIND 3 N N AT CGMR WIND 3 N N AT CGSN WIND 3 N N AT CSCS WIND 4 N N AT WPCS WIND 4 N N AT CIMI WIND 4 Y N AT CCID WIND 1 Y N AT GCAP WIND 3 N N A Depends on previous command Depends on prev command N AT CPOF WIND 3 without SIM N N WIND 1 with SIM AT CFUN WIND 3 N N AT CPAS WIN
261. range networks have been detected AT4COPS 1 2 20810 CME ERROR 32 Note Ask for registration on SFR network Note Network not allowed emergency calls only AT COPS 1 2 23433 CME ERROR 529 Note Ask for registration on UK Orange Note Selection failed emergency calls only network AT COPS 0 OK Note Ask for registration in automatic mode Note Succeeded AT COPS 3 0 OK Note Set lt format gt to long alphanumeric AT COPS COPS 0 0 Orange F OK Note Ask for current PLMN Note Home PLMN is France Telecom Orange AT COPS 2 OK Note Ask for deregistration from network Note Succeeded AT COPS COPS 2 Note Ask for current PLMN Note ME is unregistered until lt mode gt 0 or 1 is selected Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 32 Chapter 6 Network Service Commands Network Registration CREG Description This command is used by the application to ascertain the registration status of the product Values lt mode gt 0 Disable network registration unsolicited result code default 1 Enable network registration code result code CREG stat 2 Enable network registration and location information unsolicited result code CREG lt stat gt lt lac gt lt ci gt if there is a change of network cell lt stat gt 0 Not registered ME is not currently searching for a new operator Registered home network Not registered ME currently searching for a new ope
262. rator to register to Registration denied Unknown Registered roaming lac String type two byte location area code in hexadecimal format e g 00C3 equals 195 in decimal ci String type two byte cell ID in hexadecimal format cO 0 NA Syntax Command Syntax AT CREG mode Response syntax CREG mode stat lac ci for AT CREG Command only Command Possible responses AT CREG CREG lt mode gt lt stat gt OK Note As defined here above AT CREG 0 OK Note Disable network registration unsolicited result code Note Command valid AT CREG 1 OK Note Enable network registration unsolicited result code Note Command valid AT CREG 2 OK Note Enable network registration and location Note Command valid information unsolicited result code AT CREG CREG 0 2 Note 0 1 2 lt mode gt values are supported Operator List Management WOLM Description This command allows a new or modified operator to be added to the PLMN list Up to 10 PLMNs can be created and stored in the flash memory Please note that if two entries with the same network MCC MNC but have different names are entered the first entry will be used Values lt mode gt 0 Delete 1 Write 2 Read lt loc gt Location If this parameter is not filled with lt mode gt 1 the location will be the first emply one lt NumOper gt Operator in numeric format lt short name gt The short
263. re then reset to zero do not show new message indication lt n gt Type of acknowledgement in PDU mode 0 send RP ACK without PDU same as TEXT mode 1 send RP ACK with optional PDU message 2 send RP ERROR with optional PDU message length Length of the PDU message Command syntax in text mode AT CNMA Command syntax in PDU mode AT CNMA n length CR Note PDU is entered using lt ackpdu gt format instead of pdu format e g SMSC address field is not present PDU is entered ctrl Z ESC Example of New Message Acknowledgement in TEXT Mode Command Possible responses AT CSMS 1 OK Note SMS AT Commands compatible with GSM 07 05 Phase 2 version AT CMGF 1 OK Note Set TEXT mode Note TEXT mode valid AT CNMI 2 2 0 0 0 OK Note lt mt gt 2 CMT 123456 98 10 01 12 30 00 00 129 4 32 240 15379 129 5 lt CR gt lt LF gt Received message Note message received AT CNMA OK Note acknowledge the message received Note send positive acknowledgement to the network AT CNMA CMS ERROR 340 Note try to acknowledge again Note no CNMA acknowledgment expected Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 61 Chapter 9 Short Messages Commands Example of New Message Acknowledgement in PDU Mode Command Possible responses AT CSMS 1 OK Note SMS AT Commands compatible with GSM 07 05 P
264. redit has expired release cause 68 with CEER command Extended Error Report CEER Description This command gives the cause of call release when the last call set up originating or answering failed Values No parameters Syntax AT CEER Command Possible responses ATD123456789 NO CARRIER Note Outgoing voice call Note Call setup failure AT CEER CEER Error lt xxx gt OK Note Ask for reason of release Note lt xxx gt is the cause information element values from GSM recommendation 04 08 or specific Call accepted Note NO CARRIER indicates that the AT CEER information is available for failure diagnosis DTMF Signals VTD VTS VTD Description The product enables the user application to send DTMF tones over the GSM network This command is used to define tone duration the default value is 70 ms 5 ms according to 3GPP 23 014 Values n tone duration This refers to an integer n that defines the length of tones emitted as a result of the VTS command This does not affect the D command A value different than zero causes a tone of duration n 100 milliseconds A value of zero default value causes a tone duration of 70 ms 5 ms Note The value is used modulo 256 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 21 Chapter 5 Call Control Commands Syntax VTDS Description Values Syntax AT VTD lt n gt
265. ring a call Values lt mode gt 0 microphone mute off default value 1 microphone mute on Syntax AT CMUT lt mode gt Command Possible responses AT CMUT CMUT 0 1 OK Note Test command Note Enable disable mute AT CMUT CMUT 0 OK Note Ask for current value Note Current value is OFF AT CMUT 1 OK Note Mute ON call active Note Command valid AT CMUT CMUT 1 OK Note Ask for current value Note Mute is active call active AT CMUT 0 CME ERROR 3 Note Mute OFF call not active Note Command not valid Speaker amp Microphone Selection SPEAKER Description This specific command selects the speaker and the microphone set Values lt ActiveSpkMic gt 0 Speaker One Micro One 1 Speaker Two Micro Two Syntax AT SPEAKER lt ActiveSpkMic gt Command Possible responses AT SPEAKER 0 OK Note Speaker ONE and Micro ONE Note Command valid AT SPEAKER SPEAKER 0 OK Note Speaker ONE and Micro ONE are active AT SPEAKER SPEAKER 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 26 Chapter 5 Call Control Commands Echo Cancellation ECHO Description This command enables disables or configures the Echo Cancellation functions for voice calls in rooms in cars etc It is necessary to tune the Microphone gain AT VGT and the Speaker gain AT VGR before activating the Echo Cancellation Notes e Y
266. ring incoming calls AG AC AB barring all calls lt mode gt 0 only lt mode gt 0 Unlocks the facility 1 Locks the facility 2 Query status class See description for the CLCK command Facility Lock or CCFC Call forwarding Note A combination of different classes is not supported It will only result in the activation deactivation status request for all classes 7 status 0 Not active 1 Active Syntax Command Syntax AT CLCK fac mode password class Response Syntax for lt mode gt 2 and command successful CLCK status lt class1 gt lt CR gt lt LF gt CLCK status class2 Command Possible responses AT CLCK 2 AO 1 1234 OK Note Command valid AT CLCK 2 AO 0 5555 CME ERROR 16 Note Wrong password AT CLCK 2 AO 0 1234 OK Note Command valid Modify SS Password CPWD Description This command changes the supplementary service password Values lt fac gt See CLCK command with only P2 facility added SIM PIN2 Note Regardless of the specified facility the change of password applies to barring all calls lt OldPassword gt NewPassword gt The password code is over 8 digits for P2 facility 4 to 8 digits The password code is over 4 digits for other facilities 1 to 4 digits Syntax Command Syntax AT CPWD lt fac gt lt OldPassword gt lt NewPassword gt Command Possible responses AT CPWD
267. rite and send messages SM SMS message storage in SIM default ME SMS message storage in Flash mem3 Memory to which received SMS are preferred to be stored SM SMS message storage in SIM default ME SMS message storage in Flash If the command is correct the following message indication is sent CPMS lt used1 gt lt total1 gt lt used2 gt lt total2 gt lt used3 gt lt total3 gt When lt mem1 gt is selected all following CMGL CMGR and CMGD commands are related to the type of SMS stored in this memory The maximum number of SMS is Flash is 99 When the modem is switched on lt mem1 gt lt mem2 gt and mem3 are initialized to SM Syntax Command Syntax AT CPMS lt mem1 gt lt mem2 gt lt mem3 gt Command Possible responses AT CPMS CPMS SM ME BM SR SM ME SM ME OK Note Possible message storages Note Read list delete SMS or SMS Status Report Write send SMS AT CPMS CPMS SM 8 10 8M 3 10 SM 3 10 OK Note Read Note Read write SMS from to SIM 3 SMS are stored in SIM 10 is the total memory available in SIM AT CPMS SM ME SM CPMS 3 10 3 99 3 10 Note Select SM for reading ME OK for writing and SM for storing AT CPMS AM CMS ERROR 302 Note Select false message storage AT CPMS BM CPMS 2 20 3 10 OK Note Select CBM message storage Note Read list delete CBM f
268. rk to the list With EF_PLMNwact present OK Note Acces technology UTRAN is selected AT CPOL 8 2 77777 Note Add a new network to the list With EF_PLMNwact present OK Note Per default Acces technology GSM is selected AT CPOL Note Ask for preferred list of networks With only EF_PLMNsel present CPOL 1 0 D1 TELEKOM CPOL 6 0 F SFR CPOL 8 2 77777 OK Note Preferred networks list in long alohanumeric format g entry is unknown so the product edits it in the numeric format AT CPOL 9 0 Orange F Note Add a new network to the list text format AT CPOL Note Ask for preferred list of networks With only EF_PLMNsel present CPOL 1 0 D1 TELEKOM CPOL 6 0 F SFR CPOL 8 2 77777 CPOL 9 0 Orange F OK Note Preferred list of networks in long alphanumeric format AT CPOL CPOL 1 16 0 2 OK Note The EF can accept 16 records Supported formats are 0 1 or 2 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 38 Chapter 6 Network Service Commands Read Operator Name COPN Description This command returns the list of all operator names in numeric and alphanumeric format stored in the module Values lt NumOper gt is the operator in numeric format lt AlphaOper gt is the operator in long alphanumeric format Syntax Command Syntax AT COPN Response Syntax COPN lt NumOper gt lt AlphaO
269. rom RAM 2 CBM are stored in RAM AT CPMS CPMS SM 3 10 ME 3 99 SM 3 10 OK Note Read Note Read store SMS from to flash write SMS to flash 3SMS are stored in flash 99 is the total memory available in flash CMTI SM 4 AT CPMS ME ME ME CPMS 3 99 3 99 3 99 Note Select ME for reading ME OK for writing and ME for storing AT CPMS CPMS ME 3 99 ME 3 99 ME 3 99 OK Note Read Note Read write store SMS from to flash 3 SMS are stored in flash 99 is the total memory available in flash CMTI ME 4 Note Receive an SMS stored in flash at location 4 AT CPMS AM CMS ERROR 302 Note Select wrong message storage Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 63 Chapter 9 Short Messages Commands Command Syntax AT CPMS lt mem1 gt lt mem2 gt lt mem3 gt continued Command Possible responses AT CPMS SM CPMS 4 10 4 99 4 99 Note Selecting SM for reading OK writing and storing has not changed AT CPMS CPMS SM 4 10 ME 4 99 ME 4 99 OK Note Read SMS from SIM Write and store SMS from to flash Preferred Message Format CMGF Description Values Syntax The message formats supported are text mode and PDU mode In PDU mode a complete SMS Message including all header information is given as a binary string in hexadecimal
270. s omitted the stored message is considered as a message to send 0 REC UNREAD 1 REC READ 2 STO UNSENT 3 STO SENT length Length of the actual data unit in bytes Command syntax in text mode index is returned in both cases AT CMGW2 lt oa da gt tooa toda lt stat gt CR Enter text lt ctrl Z ESC gt Command syntax in PDU mode AT CMGW2 length lt stat gt CR Give PDU lt ctrl Z ESC gt Response syntax CMGW lt index gt or CMS ERROR lt err gt if writing fails Command Syntax CMGW Command Possible responses AT CMGW 33146290800 lt CR gt gt Hello how are you lt ctrl Z gt Note Write a message in text mode CMGW 4 OK Note Message stored in index 4 AT CMGW s lt length gt lt CR gt lt pdu gt lt ctrl Z gt gt Note Write a message in PDU mode 1 3 lt pdu gt Note Enter message in PDU mode 2 3 lt ctrl Z gt CMGW lt index gt Note End the message 3 3 OK Note Message stored in lt index gt Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 71 Chapter 9 Short Messages Commands Send Message from Storage CMSS Description Values Syntax This command sends a message stored at location value lt index gt lt index gt lt da gt lt toda gt lt mr gt Location of stored message Desination address Type of destination address Message reference Command
271. scription Values Syntax The Supported Services include originated SMS MO and terminated short messages SMS MT as well as Cell Broadcast Message SMS CB services lt service gt 0 SMS AT commands are compatible with GSM 07 05 Phase 2 version 4 7 0 1 SMS AT commands are compatible with GSM 07 05 Phase 2 version Command Syntax AT CSMS lt service gt Command Possible responses AT CSMS 0 CSMS 1 1 1 Note SMS AT command Phase 2 OK version 4 7 0 Note SMS MO SMS MT and SMS CB supported AT CSMS 1 CSMS 1 1 1 Note SMS AT command Phase 2 Note SMS MO SMS MT and SMS CB supported AT CSMS CSMS 0 1 1 1 Note Current values OK Note GSM 03 40 and 03 41 SMS AT command Phase 2 version 4 7 0 AT CSMS CSMS 0 1 Note Possible services OK New Message Acknowledgement CNMA Description Values Syntax This command allows reception of a new message routed directly to the DTE to be acknowledged ein TEXT mode only positive acknowledgement to the network RP ACK is possible eln PDU mode either positive RP ACK or negative RP ERROR acknowledgement to the network is possible Acknowledgement with CNMA is possible only if the CSMS parameter is set to 1 CSMS 1 when a CMT or CDS indication is shown see CNMI command If no acknowledgement occurs within the network timeout an RP ERROR is sent to the network The lt mt gt and lt ds gt parameters of the CNMI command a
272. se Incoming call signal from network Final Result Codes Verbose Result Code Numeric VO set CME ERROR err Error from GSM 07 05 commands CMS ERROR err Error from SMS commands 07 07 NO ANSWER 1 8 Connection completion timeout LOK fO s Acknowledges correct execution of a command line V Incoming call signal from network Intermediate Result Codes CONNECT 14400 CSSI lt code1 gt lt index gt As verbose Supplementary service notification during a call setup Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 179 Appendix A Result Codes Failure Causes Other Tables Parameter Storage Mode Parameter Storage Mode AT amp W Command AT CSAS AT amp F SIM E2P E2P SIM E2P E2P Command Default values General commands CMEE CSCS WPCS D ATSO CICB CSNS SIDET SPEAKER Oo 0 4CICB CSNS ECHO 1 0 3 10 7 Algo ID 1 3 30 8000 256 Algo ID 3 SIDET P42 0 SPEAKER 1 2 0 ic 1 VGR 128 speaker 1 0 others POU POU POU ILRR X fo 0 0 1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 180 Appendix A Result Codes Failure Causes Other Tables Parameter Storage Mode AT amp W Command AT CSAS AT amp F SIM Command E2P
273. se from the user e END SESSION User abort The values are listed after the Command Syntax Table Command syntax STGR lt CmdType gt lt Result gt lt Data gt Command Possible responses AT STGR lt CmdType gt lt Result gt lt Data OK CME ERROR lt err gt OK CME ERROR lt err gt For Getlnput with lt Result gt 1 AT STGR 3 1 lt CR gt lt Data gt lt Ctrl Z gt For Getlnkey with lt Result gt 1 OK AT STGR 2 1 lt Data gt CME ERROR lt err gt AT STGR OK lt CmdType gt 0 Item selection in the main menu 1 User confirmation to clear a Disp Text 2 Response for a Get Inkey 3 Response for a Get Input 4 Response for a Setup call 6 Response for a Sel Item 11 Reponse for a Setup event list 95 Backward move 96 Command beyond ME capabilities 97 ME currently unable to process command 98 No response from the user 99 User abort Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 146 Chapter 14 SIM Toolkit Values when CmdType 0 Select an item from the main menu lt Result gt 1 Item selected by the user 2 Help information required by user Data Contains the item identifier of the item selected by the user Values when CmdType 1 Confirm the display text clearin No values Values when CmdType 2 Get Inke Result 0 Session ended by user 1 Response given by the user 2 Help information
274. solicited report of CCM value Note CCM report deactivated AT CAOC 2 OK Note Activate unsolicited report of CCM value Note CCM report activated AT CAOC CAOC lt mode gt Note Request mode OK Note Display unsolicited report mode 1 or 2 AT CAOC CAOC 0 2 Note Request supported modes OK Note 0 1 2 modes supported Accumulated Call Meter CACM Description Values Syntax This command resets the Advice of Charge for accumulated call meter value in SIM file EFacm The ACM contains the total number of home units for both the current and preceding calls SIM PIN2 is required to reset the value If setting fails in an ME error CME ERROR lt err gt is returned The Read command returns the current value of the ACM The ACM value entered or displayed is in hexadecimal format with 6 digits lt pin2 passwd gt string type lt acm value gt string type coded as lt ccm gt under CAOC Command Syntax AT CACM lt pin2 passwd gt Possible Response CACM lt acm value gt Command Possible responses AT CACM CACM 000400 Note Request ACM value OK Note Display ACM value ACM 1024 AT CACM 1234 OK Note Request ACM reset real PIN2 is 1234 Note ACM value is reset AT CACM 0000 CME ERROR 16 Note Request ACM reset with wrong PIN2 value Note Incorrect password AT CACM CACM 000000 Note Request ACM value OK Note Display ACM value ACM 0 Multi T
275. sparent Values mode 0 Disable extended reports 1 Enable extended reports Syntax Command syntax AT CR lt mode gt Command Possible responses AT CR 0 OK Note Extended reports disabled Note Command valid AT CR 1 OK Note Extended reports enabled Note Command valid AT CR CR 1 OK AT CR CR 0 1 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 94 Chapter 11 Data Commands Cellular Result Codes CRC Description This command shows more detailed ring information for an incoming call voice or data Instead of the string RING an extended string is used to indicate which type of call is ringing e g CRING VOICE These extended indications are CRING ASYNC for asynchronous transparent CRING REL ASYNC for asynchronous non transparent CRING VOICE for normal speech Values lt mode gt 0 Disable extended reports 1 Enable extended reports Syntax Command syntax AT CRC lt mode gt Command Possible responses AT CRC 0 OK Note Extended reports disabled Note Command valid AT CRC 1 OK Note Extended reports enabled Note Command valid AT CRC CRC 1 OK AT CRC CRC 0 1 OK DTE DCE Local Rate Reporting ILRR Description This parameter controls whether or not the extended format ILRR lt rate gt information text is transmitted from the DCE to the DTE The lt rate gt reported represents th
276. stat gt possible values status of messages in memory Text mode PDU mode Status of messages in possible values possible values memory REC UNREAD 0 received unread messages REC READ 1 received read messages STO UNSENT 2 stored unsent messages STO SENT 3 stored sent messages ALL 4 all messages Note For SMS Status Reports only ALL 4 and READ 1 values of the stat parameter will list messages other values will only return OK Syntax Command syntax AT CMGL lt stat gt Response syntax for text mode CMGL index stat da oa alpha scts lt tooa toda gt lt length gt CR LF data for SMS DELIVER and SMS SUBMIT CMGL index stat fo mr May be followed by other lt CR gt lt LF gt CMGL lt index gt lt ra gt lt tora gt lt scts gt lt dt gt lt st gt for SMS STATUS REPORT only May be followed by other lt CR gt lt LF gt CMGL lt index gt Response syntax for PDU mode CMGL lt index gt lt stat gt alpha length lt CR gt lt LF gt lt pdu gt for SMS DELIVER SMS SUBMIT and SMS STATUS REPORT May be followed by other lt CR gt lt LF gt CMGL lt index gt Command Possible responses AT CMGL REC UNREAD Note List unread messages in text mode CMGL 1 REC UNREAD 0146290800 CR LF I will be late CMGL 3 REC UNREAD 46290800 lt CR gt lt LF gt See you tonight OK
277. state If the modem is already in the requested state the command is ignored and the OK response is returned If the requested state cannot be achieved an ERROR or CME ERROR response is returned Extended error responses are enabled by the CMEE command Any active PDP contexts will be automatically deactivated when the attachment state changes to detached The read command returns the current GPRS service state The test command is used for requesting information on the supported GPRS service states lt state gt Indicates the state of GPRS attachment 0 Detached 1 Attached 2 Combined detach GPRS and GSM detach in the same network request Other values are reserved and will result in an ERROR response to the execution command Command Syntax AT CGATT Possible Responses AT CGATT lt state gt OK ERROR AT CGATT CGATT lt state gt OK AT CGATT CGATT list of supported lt state gt s OK AT CGATT 1 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 155 Chapter 15 GPRS Commands PDP Context Activate or Deactivate CGACT Description Values Syntax The execution command activates or deactivates the specified PDP context s After the command has completed the modem remains in V 25ter command state If any PDP context is already in the requested state the state for that context remains unchanged If the requested state for any specified context cannot be ach
278. suppression allow CLI presentation Control of CUG supplementary service information by G or g is allowed for this call only The index and info values set with the CCUG command are used An outgoing call attempt could be refused if the AOC service is active and credit has expired NO CARRIER When trying to set up an outgoing call while there is an active call the active call is first put on hold then the call set up is carried out As per GSM 02 30 GSM sequences may be controlled using dial commands These sequences can contain but is forbidden If the sequence is not supported or fails CME ERROR lt err gt is returned In the case where the FDN phonebook is activated the sequences concerning call forwarding are allowed only if they are written in the FDN See Codes and Values Appendix for the list of supported sequences Command Possible responses ATD 21 CCFC 0 7 Note Check any call forwarding status Note No call forwarding ATD 61 33146290800 25 OK Note Register call forwarding on no reply with no reply Note done timer fixed at 25 s ATD 2 CME ERROR 3 Note Bad sequence Hang Up Command H Description Values Syntax The ATH or ATHO command disconnects the remote user In the case of multiple calls all calls are released active on hold and waiting calls The specific ATH1 command has been appended to disconnect the current ou
279. syntax AT CMSS lt index gt lt da gt lt toda gt Response syntax CMSS mr or CMS ERROR err if sending fails If a new recipient address lt da gt is given it will be used instead of the one stored with the message Command Possible responses AT CMGW 0660123456 lt CR gt CMGW 5 Today is my birthday OK Note Message stored with index 5 AT CMSS 5 0680654321 AT CMSS lt mr gt OK Note Send the message 5 to a different destination number Note Successful transmission Set Text Mode Parameters CSMP Description Values This command selects values for lt vp gt lt pid gt and lt dcs gt lt fo gt lt pid gt lt dcs gt byte comprises 6 different fields b7 b6 b5 b4 b3 b2 b1 bO RP UDHI SRR VPF RD MTI Note fo must be entered in DECIMAL format Hexadecimal format would lead to irrelevant results RP Reply Path not used in text mode UDHI User Data Header Information b6 1 if the beginning of the User Data field contains a Header in addition to the short message This option is not supported in CSMP command but can be used in PDU mode CMGS SRR Status Report Request b5 1 if a status report is requested This mode is supported VPF Validity Period Format b4 0 amp b3 0 gt vp field is not present b4 1 amp b3 0 vp field is present in relative format Others formats absolute amp enhanced are not supported RD Reject Duplicates b2 1
280. t Command Possible responses AT CMTI SM 1 Note New message received AT CMGR 1 Note Read the message CMGR REC UNREAD 0146290800 98 10 01 18 22 11 00 lt CR gt lt LF gt ABCdefGHI OK AT CMGR 1 CMGR REC UNREAD 0146290800 Note Read the message again 98 10 01 18 22 11 00 lt CR gt lt LF gt ABCdefGHI OK Note Message is read now AT CMGR 2 OK Note Location empty AT CMGF 0 CMGR 1 Note In PDU mode CMGR 2 lt length gt lt CR gt lt LF gt lt pdu gt OK Note Message is stored but unsent no alpha field AT CMGF 1 CPMS SR CNMI 2 Reset to text mode set read memory to SR and allow storage of further SMS Status Report into SR memory OK AT CMSS 3 CMSS 160 Send an SMS previously stored OK CDSI SR 1 New SMS Status Report stored in SR memory at index 1 AT CMGR 1 Read the SMS Status Report CMGR REC UNREAD 6 160 33612345678 129 01 05 31 15 15 09 00 01 05 31 15 15 09 00 0 OK Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 68 Chapter 9 Short Messages Commands List Message CMGL Description This command allows the application to read stored messages by indicating the type of the message to read The messages are read from the memory selected by the CPMS command Values lt
281. t PLMN names in the ROM defined according to MoU SE 13 and NAPRD Operator 1 E ONS 2 CPHS CPHS ONS 3 SPN If on Home PLMN use SIM file SPN Ox6F46 if present 4 NITZ message is sent on a GPRS attachment FLASH 5 ROM Names documents Note AT command Once a long name is found following this priority order it is given as a response to the Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 34 Chapter 6 Network Service Commands Values lt mode gt 0 Use long alphanumeric format 1 Use short alphanumeric format 2 Reserved for future use 3 Erase NITZ PLMN list if lt NumOper gt 0 4 Access to EEPROM to read or write the method to use for getting PLMN names Read access if NumOper omitted Write access if NumOper 2 PlmnOns provided lt NumOper gt is the operator in numeric format lt AlphaOper gt is the operator in long or short alphanumeric format see Codes and Values for Operator Names in the Appendix lac is the two byte Location Area Code to be used to get the PLMN name If it is not entered the current lac will be used 0 if limited service It is provided as an integer value lt PlmnOns gt is a bit field with the following coding Bit 0 E ONS Bit 1 CPHS Bit2 SPN Bit 3 NITZ Bit4 FLASH Bit 4 FLASH Bit3 NITZ Bit2 SPN Bit1 CPHS Bit 0 E ONS Bit value is 1 for Activate and 0 for Deactivate the method lt
282. t DCE_by_DTE gt 0 none supported 1 Xon Xoff local circuit 103 not supported 2 RTS supported 3 Xon Xoff global on circuit 103 not supported Important Note When this parameter is set to 2 DTE invokes flow control through RTS DCE behaviour is as follows e If the DCE has never detected RTS in the high or ON condition since startup then it ignores RTS as it assumes that this signal is not connected e As soon as the DCE detects RTS high the signal acts on it Therefore subsequent RTS transition to OFF will prevent the DCE from sending any further data in both online and offline modes e This behavior allows the user to use the default settings hardware flow control and leave RTS disconnected In the case where RTS is connected and is high at least once it acts on the DCE lt DTE by DCE gt 0 none supported 1 Xon Xoff circuit 104 not supported 2 CTS supported Note When this parameter is set to O none then CTS is kept high all the time Syntax Command syntax AT IFC DCE by DTES DTE by DCE Command Possible responses AT IFC IFC 2 2 OK Note Current values AT IFC IFC 0 2 0 2 OK Note Possible values AT IFC 0 0 OK Note New values Set DCD Signal amp C Description This commands controls the Data Carrier Detect DCD signal Values lt n gt 0 DCD always on 1 DCD matches the state of the remote modem s data carrier Syntax Command syntax AT a
283. t lt ERROR gt gt 1 Enable lt lt CME ERROR xxx gt gt or lt lt CMS ERROR lt xxx gt gt gt Syntax AT CMEE lt error reporting flag Command Possible responses AT CMEE CMEE 0 1 OK AT CMEE 0 OK Note Disable ME error reports use only lt lt ERROR gt gt AT CMEE 1 OK Note Enable lt lt CME ERROR lt xxx gt lt lt or lt lt CMS ERROR lt xxx gt gt gt Keypad Control CKPD Description Emulates the modem keypad by sending each keystroke as a character in a lt keys gt string The supported GSM sequences are listed in the Appendix A If emulation fails a CME ERROR err is returned If emulation succeeds the result depends on the GSM sequence activated Note In the case where the FDN phonebook is activated the sequences concerning call forwarding are allowed only if the entire sequence is written in the FDN Values keys Keyboard sequence string of the following characters 0 9 Syntax AT CKPD lt keys gt Command Possible responses AT CKPD 21 CCFC 0 7 Note Check every call forwarding status AT CKPD 1234 CME ERROR 3 Note Sequence not allowed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 17 Chapter 4 General AT Commands Clock Management CCLK Description Values Syntax Sets or gets the current date and time of the ME real time clock lt date and t
284. t phone functionality eesssss 16 CGACT PDP Context Activate or Deactivate 156 CGANS Manual Response to Network Request for PDP Context ActiVatlor ceci rte coe eeeeedeacie 165 xOGATT Attachior Detach 2 reas 155 CGAUTO Automatic Response to Network Request for PDP Context ACDVallpti cuisses ntn tur irte o Se edidoe 164 CGCLASS GPRS Mobile Station Class 158 CGDATA Enter Data State 157 CGDCONT Define PDP Context 00 eee 149 CGEREP GPRS Event Reporting 160 CGMI Manufacturer identification 13 CGMM Request Model Identification 13 CGMR Request revision identification CGPADDR Show PDP Address CGQMIN Quality of Service Profile Minimum Acceptable Sede ene dep cde sepa E de oe kc cede Sun eoi Loss ipse EROR RNC 154 CGQREQ Quality of Service Profile Requested 15i CGREG GPRS Network Registration Status 161 CGSMS Select Service for MO SMS Messages 159 CHLD Call Related Supplementary Services 87 CICB Incoming Call Bearer sesssss 24 FGCIMI REQUEST IMS irinin 15 CKPD Keypad control eeeeeeneene 17 GLOC List Gurrent Geallls scrsscccssscajenneesecencenexyeeateseqares 88 SOLECK Call Barnig uu cec etre ER 81 SOLEOK Facility LOCK iisstacune duende 43 CLIP Call
285. tgoing call only in dialing or alerting state i e ATH1 can be used only after the ATD command and before its terminal response OK NO CARRIER It can be useful in the case of multiple calls lt n gt 0 Ask for disconnection default value 1 Ask for outgoing call disconnection ATH n Command Possible responses ATH OK Note Ask for disconnection Note Every call if any is released ATH1 OK Note Ask for outgoing call disconnection Note Outgoing call if any is released Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 20 Chapter 5 Call Control Commands Answera Call A Description When the product receives a call it sets the RingInd signal and sends the ASCII RING or CRING lt type gt string to the application CRING if the cellular result code CRC is enabled Then it waits for the application to accept the call with the ATA command Values No parameters Syntax ATA Command Possible responses RING Note Incoming call ATA OK Note Answer to this incoming call Note Call accepted ATH OK Note Disconnect call Note Call disconnected Remote Disconnection This message is used by the product to inform the application that an active call has been released by the remote user The product sends NO CARRIER to the application and sets the DCD signal In addition for AOC the product can release the call if c
286. tgoing calls are barred 6 incoming calls are barred 7 CLIR suppression rejected lt code2 gt 0 this is a forwarded call MT call setup closed User Group call with CUG lt index gt call has been put on hold during a voice call number amp type fields may be present call has been retrieved during a voice call number amp type fields may be present multiparty call entered during a voice call number amp type fields may be present call on hold has been released during a voice call call is being connected alerting with the remote party in alerting state in Explicit Call Transfer operation during a voice call 8 call has been connected with the other remote party in Explicit Call Transfer operation during a voice call number amp type fields may be present O10 NA index Closed User Group index number String type phone number type Type of address Command syntax AT CSSN n m When lt n gt 1 and a supplementary service notification is received after a mobile originated call setup intermediate result code CSSI lt code1 gt lt index gt is sent before any other MO call setup result codes When m 1 and a supplementary service notification is received during a call unsolicited result code CSSU lt code2 gt lt index gt lt number gt lt type gt is sent Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 89 Chapter 10
287. the checksum of SIM phonebooks after loading An interruption has occurred The rack has been detected as Closed Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 109 Chapter 13 Specific AT Commands 14 The rack has been detected as Open 15 The modem received a NITZ information message from the network 16 SMS and SMS CB services are ready For Event 10 lt phonebook gt SIM phonebook SM FO ON SN EN lt status gt 0 Not Reloaded from SIM no change since last init or SIM remove 1 Reloaded from SIM to internal memory at least one entry has changed For Event 11 lt checksum gt 128 bit fingerprint of the phonebook Note If the service of the phonebook is not loaded or not present the checksum is not displayed and two commas without checksum are displayed For Event 15 Full name String Updated long name for current network Short name String updated short name for current network Local time zone Signed integer Time Zone indicates the difference expressed in quarters of an hour between the local time and GMT Universal time and local time zone String Universal Time and Time Zone in format yy MM dd hh mm ss zzz Year Month Day Hour Min Seconds Time Zone The Time Zone indicates the difference expressed in quarters of an hour between the local time and GMT lt LSA Identity Hexa string LSA identity of t
288. the product this command controls the preferred error correcting mode for a data connection It can only be used for transparent data transmission If the MNP2 feature is provided the product authorizes MNP error correction mode Values lt n gt 0 Default Disables error correction mode 5 Selects MNP error correction mode Note E prefixed commands of V 25 ter are not used Syntax Command syntax AT N lt n gt Command Possible responses AT NO OK Note no error correction AT N 0 Note Current value OK Note Command valid AT N4 CME ERROR 3 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 98 Chapter 12 V 24 and V 25 Commands Chapter 12 V 24 and V 25 Commands Important All commands described hereafter will to the currently selected and used UART Fixed DTE Rate IPR Description This commands specifies the data rate at which the DCE will accept commands Notes e The serial autobauding feature is supported and covers the following serial speeds only 2400 4800 9600 19200 38400 57600 bps Beyond those serial speeds proper operation of the modem is not guaranteed Any AT command issued by the DTE must start with both capital A and T or or both lower case a and t or otherwise the DCE may return some garbage characters and become desynchronized Should this happen the DTE simply issues ATV at 2400 or 480
289. this phone number CPBP 15 331290101 145 8045682344FFFF OK Note Display entry corresponding to the specified phone number UCS2 format AT CPBP 0129 Note Search entries corresponding to this phone number CME ERROR 22 Note Entry not found AT CPBS SM OK Note ADN phonebook AT WCOS 0 OK Note Phonebook not extended AT CPBP 0123456789 Note Search entries correspondeing to this phone number CPBP 1 0123456789 129 Test ADN Note Display the entry corresponding to the specified phone number AT WCOS 1 Note Phonebook extended OK AT CPBP 0123456789 Note Search entries correspondeing to this phone number CPBF 1 0123456789 129 Test ADN O Note Display locations with text field starting with Test extended entry AT CPBS ME OK Note ADN phonebook AT WCOS 0 OK Note Phonebook not extended AT CPBP 0123456789 Note Search entries correspondeing to this phone number CPBP 1 0123456789 129 Test ME Note Display locations with text field starting with Test Continued on next page Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number 80002931 53 Chapter 8 Phonebook Commands AT CPBP lt PhoneNumber gt continued Command Possible responses AT WCOS 1 OK Note Phonebook extended AT CPBP Test CPBF 1 0123456789 129 Test Note Read entries with Test ME
290. ticatiom O GID wai iiie teess 15 Change or Do Not Change SMS Status WUSS 77 Clock Management CCLK ssseeses 18 Copy Messages WMOP sesee 78 Keypad control CR PD saei rris 17 Delete Message CMQGQD sees 73 Manufacturer Identification CGMI 18 List Message 4G M Gigi iieri acredite 69 Phone activity status 4CPAS esesss T7 Message Overwriting WMQGO seseses 76 Phonebook Character Set WPCS 14 Message Status Modification WMSC 75 Power Off CPOP ceccceseeeseeceeeeeseeeseaeeeseeessaeeenaees 16 More Messages to Send CMMS sssss 79 Product Serial Number CGSN sees 14 New Message Indication CNM1L 66 Repeat last command A eeeeseuusss 15 Preferred Message Format CMGE 64 Report Mobile Equipment errors CMEE 17 Preferred Message Storage CPMS 63 Request IMSI CIMI eeseeeeeeeeeneeeeneee 15 Read Message CMGR seen 68 Request Model Identification x CGMM 13 Restore Settings CRES sss 65 Request revision identification CGMR 13 SAVE Settings HOSAS aeiia eae 65 Select T
291. tivity event 3 Reporting asked for Idle Screen and User Activity events 4 Cancellation of reporting event Note For the UCS2 format texts are displayed in Hexa ASCII format Example When the SIM sends a TextString containing 0x00 0x41 the text displayed is 0041 Error Codes for the SIM Toolkit Get Information Command CME ERROR 3 Operation not allowed This error is returned when a wrong parameter is detected CME ERROR 4 Operation not supported This error is returned when the user wants to get information about a SIM Toolkit pro active command with SIM Toolkit functionality not activated CME ERROR 518 SIM Toolkit indication not received This error is returned when the SIM Toolkit indication STIN has not been received Example Initially all facilities are activated The PIN is not required and SIM Toolkit functionality is activated AT CMEE 1 Enable the reporting of mobile equipment errors OK AT WIND 15 Set indications OK AT STSF STSF 1 5FFFFFFF7F 3 SIM Toolkit functionality activated with all facilities OK STIN 0 The main menu has been sent from the SIM AT STIN STIN 0 OK AT STGI 0 Get information about the main menu STGI SIM TOOLKIT MAIN MENU Main menu contains 3 items STGI 1 3 BANK 0 STGI 2 3 QUIZ 0 STGI 8 3 WEATHER 0 OK AT STIN CME ERROR 4 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 145 Chapter 14
292. to 60 1 2 If there are no more free records in the EFgxr the behavior is e ifthe user tries to store an entry that exceeds 20 digits CME 20 e ifthe user tries to dial an number that exceeds 20 digits CME 20 Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 11 Chapter 3 General Behaviors Since the maximum length for the numbers in the ADN FDN and LND phonebooks is 60 digits e ifthe user tries to dial a number that exceeds 60 digits CME 3 Before the user can perform a call the number of free records in the EFgxr is checked for availability of free space to store this number e l fthere are free records left the call is setup e Otherwise CME 20 error is returned Memory Full See Recommendation 3GPP 11 11 for more details Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 12 Chapter 4 General AT Commands Chapter 4 General AT Commands Manufacturer Identification CGMI Description Values Syntax Displays the manufacturer identification No parameters AT CGMI Command Possible responses AT CGMI WAVECOM MODEM OK Note Get manufacturer identification Note Command valid Wavecom modem Request Model Identification CGMM Description Values Syntax Displays the supported frequency bands With multi band products the response may be a combination of different bands No
293. tor functionality is activated CPHS 6 1 CPHS Information functionality is activated CPHS 7 1 Customer Service Profile functionality is activated OK RK WVMI 1 1 A message is waiting on Line 1 AK WVMI 2 1 A message is waiting on Line 2 Activate Divert Call Indicator functionality call forwarding is active on Line 1 OK WDCI 1 1 Interrogate the status of voice mail indicator functionality WVMI 1 1 a message is waiting on LINE 1 WVMI 2 1 a message is waiting on LINE 2 WVMI 3 0 no data waiting WVMI 4 0 no fax waiting OK Activate the mail box number functionality OK Interrogate the status of activated Line WALS 2 Current line is number 2 OK Deactivate the Divet Call Indicator functionality OK Interrogate the status of CPHS functionality CPHS 1 1 Voice mail indicator functionality is activated CPHS 2 1 The mail box number functionality is activated CPHS 3 1 Alternate Line Serve functionality is activated CPHS 4 0 Divert Call Indicator functionality is deactivated CPHS 5 1 Network Operator functionality is activated CPHS 6 1 CPHS Information functionality is activated CPHS 7 1 Customer Service Profile functionality is activated OK Query current mail box numbers in SIM WMBN 1 19254871234 129 1 Mail box number for Line 1 WMBN 2 1 Mail box number for Line 2 WMBN 3 1 Mail box number for data Line WMBN 4 1 Mail box number for fax Line OK Only Line can be updated Multi
294. trol CR Description This command enables a more detailed service reporting for incoming or outgoing calls Before sending the CONNECT response to the application the GSM modem will precisely define the type of data connection being established These report types are CR ASYNC For asynchronous transparent CR REL ASYNC For asynchronous non transparent For GPRS j 4CR GPRS For GPRS Values No parameters Syntax Command syntax AT CR Command Possible responses AT CR 0 OK Note Extended reports disabled Note Command valid AT CR 1 OK Note Extended reports enabled Note Command valid Extended Error Report CEER Description This command gives the reason of the call release when the last call setup originating or answering failed New indication for GPRS is the reason of the last unsuccessful PDP context activation and the last GPRS detach or PDP context activation Values No parameters Syntax Command Syntax AT CEER Command Possible Responses ATD123456789 NO CARRIER Note Outgoing voice call Note Call setup failure AT CEER CEER Error lt xxx gt OK Note Ask for reason of release Note lt xxx gt is the cause information element values form GSM recommandation 04 08 or specific Call accepted NO CARRIER indicates that the AT CEER information is available for a failure diagnostic See Failure Cause from GSM 04 08 Recommendation in Appendix A Multi Tech Systems
295. ts The following unsolicited result codes and the corresponding events are defined CGEV REJECT PDP type lt PDP_addr gt A network request for PDP context activation occurred when the modem was unable to report it to the DTE with a CRING unsolicited result code and was automatically rejected CGEV NW REACT PDP type lt PDP_addr gt lt cid gt The network has requested a context reactivation The lt cid gt that was used to reactivate the context is provided if known to the modem CGEV NW DEACT lt PDP_type gt lt PDP_addr gt lt cid gt The network has forced a context deactivation The lt cid gt that was used to activate the context is provided if known to the modem CGEV ME DEACT lt PDP_type gt lt PDP_addr gt lt cid gt The mobile equipment has forced a context deactivation The lt cid gt that was used to activate the context is provided if known to the modem CGEV NW DETACH The network has forced a GPRS detach This implies that all active contexts have been deactivated These are not reported separately CGEV ME DETACH The mobile equipment has forced a GPRS detach This implies that all active contexts have been deactivated These are not reported separately CGEV NW CLASS class The network has forced a change of MS class The highest available class is reported CGEV ME CLASS class The mobile equipment has forced a change of MS class The highest available class is reporte
296. ud rate with AT amp W before directly sending the AT CFUN 1 command lt functionality level gt 0 Set minimum funtionality IMSI detach procedure 1 Set the full functionality mode with a complete software reset AT4 CFUN functionality level Command Possible responses AT CFUN CFUN 1 Note Ask for current functionality level OK Note Full functionality AT CFUN 0 OK Note Set minimum functionality IMSI detach procedure Note Command valid AT CFUN 1 OK Note Set the full functionality mode with a complete software reset Note Command valid Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 16 Chapter 4 General AT Commands Phone Activity Status CPAS Description Returns the activity status of the mobile equipment Values pas 0 ready allow commands from TA TE 1 unavailable does not allow commands 2 unknown 3 ringing ringer is active 4 callin progress 5 asleep low functionality Syntax AT CPAS Command Possible responses AT CPAS CPAS lt pas gt Note Current activity status OK Report Mobile Equipment Errors CMEE Description Disables or enables the use of the CME ERROR lt xxx gt or CMS ERROR lt xxx gt result code instead of simply ERROR See the Appendix for CME ERROR Result Codes description and CMS ERROR result codes Values lt error reporting flag gt 0 Disable ME error reports use only l
297. ues AT WPCS lt Character Set Command Possible responses AT WPCS TRANSPARENT OK Note Transparent mode Note Command valid AT WPCS CUSTOM OK Note Custom character set Note Command valid AT WPCS WPCS TRANSPARENT HEX CUSTOM OK Note Get possible values Note Possible values Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 14 Chapter 4 General AT Commands Request IMSI CIMI Description Reads and identifies the IMSI International Mobile Subscriber Identity of the SIM card The PIN may need to be entered before reading the IMSI Values No parameters Syntax AT CIMI Command Possible responses AT CIMI 208200120320598 Note Read the IMSI OK Note IMSI value 15 digits starting with MCC 3 digits MNC 2 digits 3 for PCS 1900 Card Identification CCID Description Orders the product to read the EF CCID file on the SIM card Values No parameters Syntax AT CCID Command Possible responses AT CCID CCID 123456789AB1 11213141 Note Get card ID Note EF CCID is present hexadecimal format AT CCID CCID 123456789AB111213141 Note Get current value Note Same result as CCID AT CCID OK Note Get possible value Note No parameter but this command is valid Note If there is no EF CCID file present on the SIM the CCID answer will not be sent but the OK message will be return
298. unctionality A Class A highest B Class B CG Class C in GPRS only mode cc Class C in circuit switched only mode lowest Other values are reserved and will result in an ERROR response to the set command If the modem is GPRS attached when the set command is issued with a class CC specified a GPRS detach request is sent to the network If the modem is GSM attached when the set command is issued with a class CG specified a GSM detach request is sent to the network Class A is not supported Note During switch On in CG class the modem always performs an automatic GPRS attach the ATTACH STATUS parameter of WGPRS is ignored But if the modem is not already GPRS attached when switching from B CC class to CG class then no automatic GPRS attach is performed Example of the Automatic Attachment See Note Above Syntax AT CGCLASS CGCLASS B OK AT CGATT CGATT 0 OK AT CGCLASS CG OK AT CGATT CGATT 0 OK AT CGATT 1 OK AT CPOF OK AT CFUN 1 OK AT CGCLASS CGCLASS CG OK AT CGATT CGATT 1 OK Command Syntax AT CGCLASS Possible Response s AT CGCLASS lt class gt OK AT CGCLASS CGCLASS lt class gt OK AT CGCLASS CGCLASS list of supported lt class gt s OK AT CGCLASS CG OK Note Enter GPRS Class C mode Note Enter GMS mode AT CGCLASS A CME ERROR 150 Note Chosen class not supported AT CGCLASS CGCLASS CG CC OK AT CGCLAS
299. upported by the customer application e The lt Timeout gt parameter multiple of 10 seconds sets the maximum time the user has for reacting to select an item to input a text etc e When the Autoresponse is activated the STIN indication for Play Tone 5 Refresh 7 Send SS 8 Send SMS 9 or Send USSD 10 is automatically followed by the corresponding STGI response Note about Bits Some bits are related to the product only and not to the customer application The product automatically sets these bits to either 0 or 1 whatever the user enters with the STSF command Those values are given in Appendix D Each facility is coded on 1 bit e bit 1 facility is supported by the customer application e bit 0 facility is not supported by the customer application Only the first five bytes of the TERMINAL PROFILE Class 2 can be configured The other are set to 0 See structure of TERMINAL PROFILE in APPENDIX E Syntax Command syntax STSF lt mode gt lt config gt lt Timeout gt lt AutoResponse gt Command Possible responses AT STSF lt Modes lt Config gt OK lt Timeout gt lt AutoResponse gt CME ERROR lt err gt AT STSF STSF lt Mode gt lt Config gt lt Timeout gt lt Autoresponse gt AT STSF STSF 0 2 160060C01F SFFFFFFF7F 1 255 0 1 OK SIM Toolkit Facilities Error Codes CME ERROR 3 Operation not allowed This error is returned when a wr
300. ut after reset and each GPIO default Description Values Syntax value if set as an output after reset Notes e This command is allowed only on a GPIO not allocated by the Open AT embedded application or for bus operations e When UART is activated GPIOs 0 and 5 GPO2 and GPI are not available anymore When you try to do writable or readable operations on these I O CME ERROR 3 will be returned This applies for modems running AT X50 software and supporting the multi UART feature e When the BT chip is switched on the GPIO5 is not available anymore It is not possible to change the state of the GPIO using this command GpioDir Bit table parameter indicating each GPIO direction 0 Input 1 Output Default Default value 2047 all GPIOs set as outputs lt GpioVal gt Bit table parameter indicating each output configured GPIO value each bit gives the corresponding GPIO default value 0 Reset Default 1 Set The GPIOs set as inputs by the lt GpioDir gt parameter are not affected by the value set by the lt GpioVal gt parameter Notes e lt GpioDir gt bit values for GPI and GPO are ignored e GpioVal bit values for GPI are ignored Command syntax AT WIOM lt GpioDir gt lt GpioVal gt Command Possible responses AT WIOM WIOM 2047 0 OK On reset all GPIOs are set to 0 as an output AT WIOM WIOM 0 2047 0 2047 OK Range allowed for the parameters AT WIOM 254 O
301. ve application that cannot cope with data loss Unacknowledged Acknowledged Protected Acknowledged Non real time traffic error sensitive application that can cope with infrequent data loss Unacknowledged Unacknowledged Protected Acknowledged Non real time traffic error sensitive application that can cope with data loss GMM SM amp SMS Unacknowledged Unacknowledged Protected Unacknowledged Real time traffic error sensitive application that can cope with data loss Unacknowledged Unacknowledged Unprotecte d Unacknowledged Real time traffic error non sensitive application that can cope with data loss Note For real time traffic the QoS profile also requires appropriate settings for delay and throughput peak 0 me OONOOARWNH A OD DBDCAONOOAARWN Subscribed Up to 1 000 8 kbit s Up to 2 000 16 kbit s Up to 4 000 32kbit s Up to 8 000 64 kbit s Up to 16 000 188 kbit s Up to 32 000 256 kbit s Up to 64 000 512 kbit s Up to 128 000 1 024 kbit s Up to 256 000 2 048 kbit s n Subscribed by the Network by default if value is omitted 100 0 22 bit s 200 0 44 bit s 500 1 11 bit s 1 000 2 2 bit s 2 000 4 4 bit s 5 000 11 1 bit s 10 000 22 bit s 20 000 44 bit s 50 000 111 bit s 100 000 0 22 kbit s 200 000 0 44 kbit s 500 000 1 11 kbit s 1 000 000 2
302. ve Command it is only possible to send a Terminal Response after the STIN 0 indication not after a STGI 0 request All of the Terminal Responses are not possible with all of the Proactive Commands Compatibility between available Terminal Responses and Proactive Commands is given in Appendix D Table 2 If a Terminal Response is attempted during a incompatible Proactive Command session a CME ERROR 3 will be returned Possible error codes CME ERROR 3 Operation not allowed This error is returned when a wrong parameter is detected CME ERROR 4 Operation not supported This error is returned when the user gives a response with SIM Toolkit functionality not activated Or if the SIM Toolkit indication STI N has not been received Multi Tech Systems Inc Wireless GSM GPRS AT Commands Document Number S0002931 147 Chapter 14 SIM Toolkit Example Initially all facilities are activated the PIN is not required and the SIM Toolkit functionality is activated STIN 0 The main menu has been sent from the SIM AT STGI 0 Get information about the main menu STGI 1 3 BANK O The main menu contains 3 items STGI 2 3 QUIZ 0 STGI 3 3 WEATHER O OK AT STGR 0 1 1 The item 2 of the main menu has been selected OK STIN 6 The Sel item menu has been sent from the SIM AT STGI 6 Get information about the BANK menu STGI 1 BANK The BANK menu contains two items STGI 1 2 PERSONAL ACCOUNT ENQUIRY 1 STGI 2
303. wed by the intermediate result code CONNECT The modem then enters V 25ter online data state and follows the same procedure as it would after having received a CGANS 1 with lt cid gt values specified lt n gt 0 Turn off automatic response for GPRS only For lt n gt 0 GPRS network requests are manually accepted or rejected by the CGANS command 1 Turn on automatic response for GPRS only For lt n gt 1 GPRS network requests are automatically accepted according to the description above 2 Modem compatibility mode GPRS only For lt n gt 2 automatic acceptance of GPRS network requests is controlled by the SO command Manual control uses the A and H commands respectively to accept and reject GPRS requests CGANS may also be used Incoming circuit switched calls can be neither manually nor automatically answered 3 Modem compatibility mode GPRS and circuit switched calls default For n 3 automatic acceptance of both GPRS network requests and incoming circuit switched calls is controlled by the SO command Manual control uses the A and H commands respectively to accept and reject GPRS requests CGANS may also be used Circuit switched calls are handled as described elsewhere in this specification Note In class C GPRS the modem can t receive GPRS and GSM incoming calls simultaneously Syntax Example Command Syntax AT CGAUTO Possible response s AT CGAUTO n OK ERROR AT CGAUTO
304. y lt fac gt Note Test SIM cards with MCC 001 amp MNC 01 do not check PS PN PU PP and PC locks Values lt fac gt supported facilities PS SIM lock facility with an 8 digit password SC PIN enabled lt mode gt 1 disabled mode 0 AO BACC Barr All Outgoing Calls Ol BOIC Barr Outgoing International Calls OX BOIC exHC Barr Outgoing International Calls except to Home Country AI BAIC Barr All Incoming Calls IR BIC Roam Barr Inc When Roaming outside Home Country AB All Barring services AG All outGoing barring services AC All inComing barring services PN Network lock with an 8 digit password NCK PU Network Subset lock with an 8 digit password NSCK PP Service Provider lock with an 8 digit password SPCK PC Corporate lock with an 8 digit password CCK FD SIM Fixed Dialing Numbers FDN memory feature PIN2 is required as lt password gt lt mode gt 0 unlock the facility 1 lock the facility 2 query status class A facility status can be changed for only one class or for all classes 7 or omitted 1 Voice telephony 2 Data apply to all bearer services 4 Fax facsimile services 8 Short Message service 7 Equal to all classes Default value Any attempt to combine different classes will result in activation deactivation interrogation of Voice and Data If class is omitted the default value 7 will be us

Multi-Tech Systems GPRS (MTMMC-G) Network Router User Manual

Contents

Download Pdf Manuals

Related Search

Related Contents