Home

Lenoxx Electronics G60DFV(X) Furnace User Manual

image

Contents

1. to print from a Macintosh Printer El 1 Open a Macintosh application and select the file you want resets Coe m to print Layout 13 2 Open the File menu and click Page Setup Document Pages per Sect fi E Setup in some applications EU ire 3 Choose your paper size orientation scaling and other Ayo Pireno El E val PA options and click OK Border None HJ I Printing Settings Page Attributes Hj Format for 33 A EE s Q9 Preview Save As PDF C Fax Cancel 5 Make sure that your aper Size US Letter printer is selected A Mac OS 10 3 21 59 cm Orientation s ic Te Scale 100 9 Cancel OK A Mac OS 10 3 4 Open the File menu and click Print 5 Choose the number of copies you want and indicate which pages you want to print 6 Click Print when you finish setting the options 24 Printer Features Setting The Printer Features tab provides options for selecting the paper type and adjusting print quality Select Printer Features from the Presets drop down list to access the following features Printer E Presets Standard y Printer Features A Mac OS 10 3 Paper Type Set type to correspond to the paper loaded in the tray from which you want to print This will let you get the best quality printout Resolution Quality The Resolution options you can select may vary depending on yo
2. Tray mm in Paper tray Weight Capacity BB For the best result use conventional 75 g m 20 Ib paper Ensure that the paper is of good quality and free of cuts nicks Plain paper Tray 60 to 90 g 150 sheets tears spots loose particles dust wrinkles voids and curled Letter 216 x 279 8 5 x 11 m 16 to 24 of 75 g m or bent edges A4 210 x 297 8 27 x 11 69 Ib bond 20 Ib bond A5 148 x 210 5 83 x 8 27 paper If you are unsure of what type of paper you are loading such Executive 184 x 267 7 25 x 10 5 as bond or recycled paper check the label on the package Legal 216 x 356 8 5 x 14 Manual feed eno 10591 1 sheet of The following problems may cause print quality deviations JIS B5 182 x 257 7 17 x 10 12 mode m 16 to 23 paper jamming or even damage to the printer A6 105 x 148 4 13 x 5 83 Ib bond Oficio 216 x 343 8 5 x 13 5 Problem with Folio 216 x 330 8 5 x 13 Symptom Paper Solution Envelopes Manual feed 75 to 90 g 1 sheet of Poor print quality Too moist too Try another kind of No 10 105 x 241 4 13 x 9 49 mode m 20 to 24 or toner rough too paper between 100 DL 110 x 220 4 33 x 8 66 Ib bond adhesion smooth or 250 Sheffield 4 5 C5 162 x 229 6 38 x 9 02 problems with embossed faulty moisture content C6 114 x 162 4 49 x 6 38 feeding paper lot Monarch 98 x 191 3 87 x 7 50 No 9 98 x 225 3 87 x 8 87 Dropout Stored improperly Store paper flat in its 6 3
3. Supplies and maintenance items 5 Extend the top handle on the imaging unit and then use it 8 Remove four dummy caps which are on the toner cartridge entrances of the imaging unit to pull the imaging unit out of the printer completely 6 Takea new imaging unit out of its package Remove the O Insert the toner cartridges and waste toner container into protective devices on both sides of the imaging unit and their corresponding slots until they click into place the paper protecting the surface of the imaging unit 10 Close the front cover firmly CAUTION e Don t use sharp objects such as a knife or scissors to open the imaging unit package You could damage the surface of CAUTION If the front cover is not completely closed the the imaging unit printer will not operate e Be careful not to scratch the surface of the imaging unit e To prevent damage do not expose the imaging unit to light for more than a few minutes Cover it with a piece of paper 11 Turn the printer on to protect it if necessary CAUTION if here isa y cracking sound re install 7 Holding the handles on the new imaging unit push the the imaging unit The imaging unit until it sounds click in to the printer imaging unit is not properly installed NOTE Each LED blinks red in a repeated order Wait for about 1 5 minutes for the printer to get ready 5 5 Supplies and maintenance items 4 Remove
4. e Surface smoothness The smoothness of the paper affects how crisp the printing looks on the paper CAUTION Using a material that does not conform to the specifications listed on page 8 3 can cause problems that may require service This service will not be covered by the I warranty or service agreements 3 1 Using Print Materials Type and Capacities Paper Type Capacity Plain paper 150 Envelopes 1 Labels 1 Transparency films 1 Card stocks 1 Maximum capacity may be reduced depending on the paper thickness If you load more than one sheet paper jams will occur You must load only one sheet at a time in the tray Guidelines for Paper and Special Materials When selecting or loading paper envelopes or other special materials keep these guidelines in mind e Attempting to print on damp curled wrinkled or torn paper can cause paper jams and poor print quality Use cut sheet paper only You cannot use multi part paper Use only high quality copier grade paper for the best print quality Do not use paper with irregularities such as tabs or staples Do not attempt to load the tray while printing and never overfill the tray This could cause a paper jam Avoid paper with embossed lettering perforations or a texture that is too smooth or too rough Coloured paper should be of the same high quality as white photocopy paper The pigments must be able to withs
5. This chapter explains the printing options and common printing application tasks in Windows The basic print settings are selected within the Print window These settings include the number of copies and This chapter includes print range l e Printing a Document Pant EIE e Printer Settings Printer Layout Tab Name EE Properties Paper Tab d ney Make sure that your Graphics Tab V printer is selected Comment J Print to file Other Features Tab M Print range Copies Using a Favorite Setting Al D I Using Help Pages from jus Ig r C Selection Cul BB Ke Cancel Printing a Document 3 Select your printer driver from the Name drop down list NOTES 4 To take advantage of the printer features provided by your e Your printer driver Properties window that appears in this printer driver click Properties or Preferences in the User s Guide may differ depending on the printer in use application s Print window For details see Printer However the composition of the printer properties window is Settings on page 6 similar e Check the Operating System s that are compatible with your printer Please refer to the OS Compatibility section of Screen Printer Specifications in your Printer User s Guide i i 5 Click OK to close the printer properties window If you need to know the exact name of your printer you can pigs noh check the supplied Printer so
6. 10 Advanced Printing Printing Multiple Pages on One Sheet of Paper N Up Printing You can select the number of pages to print on a single sheet of paper To print more than one page per sheet the pages will be reduced in size and arranged in the order you specify You can print up to 16 pages on one sheet 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 2 From the Layout tab choose Multiple Pages per Side in the Type drop down list 3 Select the number of pages you want to print per sheet 1 2 4 6 9 or 16 in the Pages per Side drop down list 4 Select the page order from the Page Order drop down list if necessary Check Print Page Border to print a border around each page on the sheet 5 Click the Paper tab select the paper source size and type 6 Click OK and print the document 6 wp Printing Posters This feature allows you to print a single page document onto 4 9 or 16 sheets of paper for the purpose of pasting the sheets together to form one poster size document 1 2 3 n To change the print settings from your software application access printer properties See Printing a Document on page 5 Click the Layout tab select Poster in the Type drop down list Configure the poster option You can select the page layout from 2x2 3x3 or 4x4 I
7. When you save Favorites all current driver settings are saved To use a saved setting select the item from the Favorites drop down list The printer is now set to print according to the Favorites setting you selected To delete a Favorites item select it from the list and click Delete You can also restore the printer driver s default settings by selecting Printer Default from the list Using Help Your printer has a help screen that can be activated by clicking the Help button in the printer properties window These help screens give detailed information about the printer features provided by the printer driver You can also click Mi from the upper right corner of the window and then click on any setting Advanced Printing This chapter explains printing options and advanced printing tasks NOTE I e Your printer driver Properties window that appears in this User s Guide may differ depending on the printer in use i However the composition of the printer properties window is similar e If you need to know the exact name of your printer you can check the supplied Printer software CD I This chapter includes e Printing Multiple Pages on One Sheet of Paper N Up Printing e Printing Posters i e Printing Booklets e Printing on Both Sides of Paper e Printing a Reduced or Enlarged Document e Fitting Your Document to a Selected Paper Size e Using Watermarks e Using Overlays
8. 110N Colour Up to 4 PPM in A4 Letter 6110 Resolution Up to 2400 x 600 dpi effective output Print speed will be affected by operating system used computing performance application I software connecting method media type media size and job complexity First print out time From ready Sound Pressure Level 1507779 Black and white Less than 14 seconds May be affected by operating environment printing interval media type and media size Please visit www Xerox com to download the latest software version Colour Less than 26 seconds From coldboot Black and white Less than 45 seconds I Colour Less than 57 seconds I Paper Specifications Warm up time Less than 35 seconds Power rating 110 127 VAC 5 A 50 60 Hz 220 240 VAC 3 A 50 60 Hz Overview Power consumption Average 300 W Your printer accepts a variety of print materials such as cut Power save mode Less than 17 W sheet paper including up to 100 recycled fiber content Noise level Printing mode i paper envelopes labels and custom size paper Properties Black and white Less than 49 dBA such as weight composition grain and moisture content are Colour Less than 48 dBA important factors affecting the printer s performance and the Standby mode Less than 35 dBA output quality Paper that does not meet the guidelines outlined in this User s Guide can cause the following problems Consumables life
9. Black Toner Cartridge i Approx 2 000 A4 Letter pages at 5 Coverage Poor print quality Shipped with 1 500 pages Starter toner cartridge e Yellow Magenta Cyan Toner Cartridge Approx 1 000 A4 Letter pages at 5 Coverage Shipped with 700 pages Starter toner cartridge Increased paper jams e Premature wear on the printer NOTES Waste toner container Approx 1 250 pages full Some paper may meet all of the guidelines in this guide and colour 5 image or 5 000 images still not produce satisfactory results This may be the result Imaging unit Approx 20 000 black or 50 000 of improper handling unacceptable temperature and images humidity levels or other variables over which Xerox has no I control Duty cycle Monthly Up to 24 200 images e Before purchasing large quantities of paper ensure that the Weight 13 6 kg including consumables 30 Ibs paper meets the requirements specified in this User s Guide Package weight Paper 2 4 Kg 5 29 Ibs Plastic 380 g 0 84 Ib CAUTION Using paper that does not meet these specifications External dimensions 390 x 344 x 265 mm 15 4 x 13 5 x 10 4 in may cause problems requiring repairs These repairs are not WxDxH covered by the Xerox warranty or service agreements 8 1 Specifications Supported Sizes of Paper Guidelines for Using Paper
10. G Graphics properties set 8 H help use 9 I install printer driver Linux 18 Macintosh 22 Windows 3 L Layout properties set Linux 21 Macintosh 24 Windows 6 Linux configuration tool 20 driver install 18 uninstall 20 LLP properties 21 Macintosh driver install 22 uninstall 22 printing 24 setting up the printer 23 N n up printing Macintosh 25 Windows 10 O orientation print Windows 6 overlay create 14 delete 14 print 14 P Paper properties set 7 paper size set 7 paper source set Linux 21 Windows 7 paper type set Linux 21 Macintosh 25 poster print 11 print 26 document 5 fit to page 12 from Macintosh 24 from Windows 5 N up Macintosh 25 Windows 10 overlay 14 poster 13 scaling 12 watermark 13 printer properties set Linux 21 Macintosh 24 Windows 6 printer resolution set Macintosh 25 Windows 8 printer software install Linux 18 Macintosh 22 Windows 3 uninstall Linux 20 Macintosh 22 Windows 3 printing booklets 11 double sided 12 S setting darkness 8 favorites 9 image mode 8 resolution Macintosh 25 Windows 8 toner save 8 true type option 8 software install Linux 18 Macintosh 22 Windows 3 system requirements Linux 17 Macintosh 22 uninstall Linux 20 Macintosh 22 Windows 3 status monitor use 16 system requirements Linux 17 Macintosh 22 T toner save set 8 U uninstall software Linux 20 Macintosh 22
11. Layout TAD a 6 Paper Tab ns EE 7 Graphics Tab csi ode 8 Other Features Tab sra das adria 9 Usind a Favorite Setting aaa 9 USING Help emaan aE AE A A 9 Chapter 4 ADVANCED PRINTING Printing Multiple Pages on One Sheet of Paper N Up Printing sese 10 PHI IUO POSTES per 11 Printing BOOKletS cria A A A iras 11 Printing on Both Sides Of Papel z ua tieu saa gna sans sgaqaaganamaqqaqaqqamaqawqawqyapanyawqayqawanahaquqayaushakupa 12 Printing a Reduced or Enlarged Document sse nemen nenne nennen 12 Fitting Your Document to a Selected Paper Size coococococononcncncononencncnrorenenennnrononenrnenrnrnrnreneninrnnanes 12 Using Watermarks sionista raa risu eina ENOO NP da AA 13 Using an Existing Watermark iei ada ina 13 Creating a Watermark iei eR caen ers EEdRNrRUP a MEME On aQ a ARCEM RENE ERN TANE ha 13 Editing a Watermark sis dieu sia nete se A AA e 13 Deleting a Watermark rescata tan ia 13 WSING OV FIAYS no tins sence cari ci n nanas denses Dassin sense sieste entente 14 What is an Overlay ari a 14 Creating a New Page Overlay sexos a ad daa EAE A 14 Using a Page Overlay yuy asus a ri An tan 14 Deleting a Page Overlay osa aia 14 Chapter 5 SHARING THE PRINTER LOCALLY Setting Up a Host Computer siii ii 15 Setting Up a Client Computer iii nr EEE senem seres EE ESSE ESE sees rene nennen 15 Chapter 6 USING UTILITY APPLICATIONS Using Printer Settings Utility viniera 16 Using Onscreen
12. l Watermark Edit xz o Overlay No Overlay Edit L l 3 Output Options Print Order Normal RI l l Ad 210 x 297 mm mm C inch Copies 1 Quality Normal Favorites l Printer Default l Delete I XEROX l l l Watermark You can create a background text image to be printed on each page of your document For details see Using Watermarks on page 13 overlay Overlays are often used to take the place of preprinted forms and letterhead paper For details see Using Overlays on page 14 NOTE The Overlay feature is not supported in NT 4 0 Output Options e Print Order You can set the sequence in which the pages print Select the print order from the drop down list Normal Your printer prints all pages from the first page to the last page Reverse All Pages Your printer prints all pages from the last page to the first page Print Odd Pages Your printer prints only the odd numbered pages of the document Print Even Pages Your printer prints only the even numbered pages of the document 9 Basic Printing Using a Favorite Setting The Favorites option which is visible on each properties tab allows you to save the current properties settings for future use To save a Favorites item 1 Change the settings as needed on each tab 2 Enter a name for the item in the Favorites input box XEROX 3 Click Save
13. 4 Envelop 92 x 165 3 62 x 6 5 jamming curl moisture proof wrapping Labels Manualfeed 120 to 150 g 1 sheet of I Letter 216 x 279 8 5 x 11 mode m2 32 to 40 paper Increased gray Too heavy Use lighter paper A4 210 x 297 8 3 x 11 7 Ib bond background shading printer Transparency films Manualfeed 138 to 146 1 sheet of wear Letter 216 x 279 8 5 x 11 mode g m 37 to paper a A4 210 x 297 8 3 x 11 7 39 Ib bond Excessive curl Too moist wrong Use long grain paper problems with grain direction or Card stocks Manual feed 105 to 163 1 sheet of feeding short grain Post Card 101 6 x 152 4 4 x 6 mode g m2 23to paper construction a Jamming Cutouts or Do not use paper with Minimum size Manual feed 60 to 120 g 1 sheet of damage to perforations cutouts or custom 76 x 127 3 x 5 mode m 16 to 32 paper printer perforations Maximum size Legal Manual feed MS 1 sheet of Problems with Ragged edges Use good quality mode paper feeding paper The printer supports a wide range of media sizes N N Capacity may vary depending on print material s weight and thickness and environmental con OTES ditions e Do not use letterhead paper printed with low temperature T Smoothness 100 19 250 Shetfield inks such as those used in some types of thermography e Do not use raised or embossed letterhead NOTE You may experience jams when using print materials The printer uses heat and pressure to fuse toner to the with a len
14. Proper paper loading helps prevent paper jams and ensures trouble free printing Do not remove the tray while a job is U printing Doing so may cause a paper jam See Type and Capacities on page 3 1 for acceptable paper capacities for tray Using the Tray Tray can hold a maximum of 150 sheets of plain A4 or letter sized paper It can also hold 1 sheet of special material such as cards envelopes labels and transparency To load paper pull the tray and the load the paper with the print side up For details about loading paper in the tray see Loading Paper on page 2 3 3 2 Using Print Materials If you want to print on previously printed paper the printed side should be facing up with the uncurled edge toward the printer If you experience problems with the paper feeding turn the paper around Using Manual Feed Mode If you select Manual Feed in the Source option you can manually load paper in the tray Manually loading paper can be helpful when you want to check the print quality after each page is printed If you experience a paper jam from the tray load one sheet of paper at a time into the tray 1 Load the print material in the tray with the print side up Adjust the paper guide against the print material without bending the paper 2 When you print a document you must select Manual Feed for Source from the software application and then select the correct paper size and type For details
15. Reduce the photo size Your printer has an odd smell during initial use The oil used to protect the fuser is evaporating After printing about 100 colour pages there will be no more smell It is a temporary issue Clearing Paper Jams jam will occur again Solving Problems NOTE When removing paper that is jammed in the printer if possible always pull the paper in the direction that it normally moves so as not to damage internal components Always pull firmly and evenly do not jerk the paper If the paper tears ensure that all fragments of paper are removed otherwise a paper If a paper jam occurs the H LED on the control panel lights red Find and remove the jammed paper To resume printing after clearing paper jams you must open and close the front cover or rear cover 1 Pull the tray out of the printer and remove the jammed If you cannot find the jammed paper go to the next step 2 To remove the jammed paper open the rear cover 5 Holding the inner cover open carefully take the jammed paper out of the printer The inner cover will then close automatically 3 Carefully remove the paper by pulling in the direction as shown below Most of the jammed paper can be removed in this step CAUTION Do not touch the fuser inside the inner cover It is hot AN and could cause burns The fuser s operating temperature is 180 9C 356 F Take care when removing paper from
16. automatically detects and displays new and configured print servers on your network t SET IP om t SEC00159900ba9b SEC000278e346d1 SECOO00Maeb49d SECO0000 abbfes SECO000Ma95f5c SECO0000 a79331 SECO0000 a7794e SECO0000fa3f3d SECOOD00f0a3ff32 No chage IP Address IP Address Subnet Mask Default Gatewa 59900BA9B 10 88 087 245 255 255 255 0 10 88 187 000278E346D1 10 88 187 99 255 255 255 0 10 88 187 1 ODO0DFDAEB49D 10 88 187 185 2552552650 1088187 OOOOFOABBFES 1088187186 2582552550 10881871 ODODFDASSFSC 1088187244 2682552550 10881871 0000F0A79331 10 88 187 005 2552552550 10 84874 ODODFDATTS4E 1086187227 2552552550 10881871 ODODFDA3FF3D 1088187106 2552552650 10 88 1871 ODODFDAGFF32 1088187248 2552552550 1088187 00027844780A 10 88 187 250 255 255 255 0 10 88 187 1 Exit Help 2 Select the name of your printer and click f If you cannot find your printer name click to refresh the list NOTE The refreshed list doesn t show your printer click i enter your network printer card s IP address subnet mask default gateway and then click Apply 3 Click OK to confirm the settings 4 Click Exit to close the SetIP program 4 Using SetIP 1 Open the document you want to print 3 Ba Si C Pri nti ng 2 Select Print from the File menu The Print window is displayed It may look slightly different depending on your
17. black and white mode and 4 ppm in colour mode If using Windows 98 From the Start menu choose Me the Spooling Settings and Printers Right click Setting may be set the Xerox Phaser 6110 Series incorrectly printer icon choose Properties Click the Details tab and then choose the Spool Settings button Select the desired spool setting Half the The page orientation Change the page orientation in your page is setting may be application For details see the blank incorrect Software Section The paper size and the paper size settings do not match Ensure that the paper size in the printer driver settings matches the paper in the tray Or ensure that the paper size in the printer driver settings matches the paper selection in the software application settings you use Solving Problems Problem Possible Cause Solution The paper There is too much Remove excess paper from the tray keeps paper in the tray Check that the paper guides are set Jamming correctly An incorrect type of Use only paper that meets printer paper is being used specifications There may be debris After opening the front cover inside the printer remove the imaging unit and then clear the debris The printer The printer cable is Disconnect and reconnect the prints but loose or defective printer cable Try a print job that you the text is have already printed successfully If wrong possible attach t
18. click the Status Monitor icon on the Windows task bar If an error occurs while printing the Status Monitor window appears showing the error Double click this icon NOTES Beo L5 11 33 PM To use the this program you need ad Windows 98 or higher Windows NT 4 0 can be used only for network supported printers To check for Operating System s that are compatible with your printer refer to Or from the Start menu select Programs or All Programs Printer Specifications in your Printer User s Guide Xerox Phaser 6110 Troubleshooting Guide Internet Explorer version 5 0 or higher for flash animation in HTML Help If you need to know the exact name of your printer you can Changing the Status Monitor check the supplied CD ROM Program Settings Select the Status Monitor icon on the Windows task bar and right click on the Status Monitor icon Select Option The following window opens Using the Printer Settings Utility you can configure and check Status Monitor Alert Option print settings I F Display when job is finished for network printer Using Printer Settings Utility 1 from the Start menu select Programs or All Programs Xerox Phaser 6110 Printer Settings Utility 2 Change the settings 3 To send the changes to the printer click the Apply button IV Display when error occurs during printing Schedule an automatic status checking every 32 1 10 sec Cancel Using Onscr
19. connect the printer directly to a selected computer which is called host computer on the network The following procedure is for Windows XP For other Windows OS refer to the corresponding Windows User s Guide or online help NOTES e Check the Operating System s that are compatible with your printer Please refer to the OS Compatibility section of Printer Specifications in your Printer User s Guide e If you need to know the exact name of your printer you can check the supplied Printer software CD Sharing the Printer Locally 15 Setting Up a Host Computer au Y N Start Windows From the Start menu select Printers and Faxes Double click your printer driver icon From the Printer menu select Sharing Check the Share this printer box Fill in the Shared Name field and then click OK Setting Up a Client Computer o NN O U GQ N Right click the Windows Start button and select Explorer Open your network folder in the left column Click the shared name From the Start menu select Printers and Faxes Double click your printer driver icon From the Printer menu select Properties From the Ports tab click Add Port Select Local Port and click New Port Fill in the Enter a port name field with the shared name 10 Click OK and click Close 11 Click Apply and click OK 6 Using Utility Opening the Troubleshooting Applications Guide M Double
20. display the properties shown below T3 Xerox Phaser 6110 Printing Preferences ES Layout Paper Graphics Other Features Troubleshooting r Quality C Best s n X Colour Mode Maa Coba ill C Black amp White Manual m our Salju As 210 x 297 mm clour Matching NUI HM mm C inch Copies 1 Quality Normal m Favorites Printer Default y Advanced Options paar Quality The Resolution options you can select may vary depending on your printer model The higher the setting the sharper the clarity of printed characters and graphics The higher setting also may increase the time it takes to print a document Colour Mode You can choose colour options Setting to Colour typically produces the best possible print quality for colour documents If you want to print a colour document in black and white document select Black amp White If you want to adjust the colour options manually select Manual and click the Colour Adjust or Colour Matching button e Colour Adjust You can adjust the appearance of images by changing the settings in the Levels option Colour Matching You can adjust the appearance of images by changing the settings in the Settings option Basic Printing 8 Advanced Options You can set advanced settings by clicking the Advanced Options button TrueType Options This option determines
21. drop down list box If the overlay file you want does not appear in the Overlay list click Edit button and Load Overlay and select the overlay file If you have stored the overlay file you want to use in an external source you can also load the file when you access the Load Overlay window After you select the file click Open The file appears in the Overlay List box and is available for printing Select the overlay from the Overlay List box If necessary click Confirm Page Overlay When Printing If this box is checked a message window appears each time you submit a document for printing asking you to confirm your wish to print an overlay on your document If this box is not checked and an overlay has been selected the overlay automatically prints with your document Click OK or Yes until printing begins The selected overlay downloads with your print job and prints on your document NOTE The resolution of the overlay document must be the same as that of the document you will print with the overlay Deleting a Page Overlay You can delete page overlays that you no longer use OUR WNE In the printer properties window click the Extras tab Click the Edit button in the Overlay section Select the overlay you want to delete from the Overlay List box Click Delete Overlay When a confirming message window appears click Yes Click OK until you exit the Print window Sharing the Printer Locally You can
22. suitable plug adaptor Do not remove the moulded plug WARNING If you cut off the moulded plug get rid of it straight away You cannot rewire the plug and you may receive an electric shock if you plug it into a socket IMPORTANT WARNING You must earth this machine The wires in the mains lead have the following colour code e Green and Yellow Earth e Blue Neutral e Brown Live If the wires in the mains lead do not match the colours marked in your plug do the following You must connect the green and yellow wire to the pin marked by the letter E or by the safety Earth symbol or coloured green and yellow or green You must connect the blue wire to the pin which is marked with the letter N or coloured black You must connect the brown wire to the pin which is marked with the letter L or coloured red You must have a 13 amp fuse in the plug adaptor or at the distribution board 1 Introduction Congratulations on the purchase of your printer This chapter includes e Special Features e Printer Components e Understanding the Control Panel Special Features Your new printer is equipped with several special features that will improve print quality You can Print in colour with excellent quality and speed e You can print in a full range of colours using cyan magenta yellow and black e You can print up to 2400 x 600 dpi effective output For details see the Software Section e Your printe
23. the Startup Menu icon at the bottom of the desktop Using the Configuration Tool select Linux Printer and then Configuration Tool The configuration tool accesses administrative tasks including adding and removing new printers and changing their global settings Regular users can also run it to easily inspect job queues examine printer properties and changing their local preferences To access the Configuration Tool KJ Documentation Linux Printer IZ configuration Too Multimedia P TE Linux LPR HE Networking gt T Linux Uninstall B office a Terminals Control Center Home Directory 2 Javaplugin so NW Bookmarks 8 Recent Documents Quick Browser Ed Run Command JE Configure Panel amp Lock Screen O Logout 55mso20o0ol EBEN 2 You can also access the Linux Printer Configuration window by typing in linux config from the Terminal screen 2 In the Linux Printer Configuration window select the Uninstall command from the File menu 3 The Administrator Login window appears Type in root in the Login field and enter the system password Click Proceed 1 From the Startup Menu icon at the bottom of the screen select Linux Printer and then Configuration Tool The Linux Printer Configuration window appears You can also open this window from the Terminal screen by typing in linux config The Linux Printer Configuration window shows a list of installed printers
24. the container s cap from the left side of the container as shown below and use it to close the waste Replacing the Waste Toner toner container opening Container P The life of the waste toner container unit is approximately 1 250 pages for full colour 5 image or 5 000 pages for black When the life span of the waste toner container has expired the Status Monitor program window appears on the computer indicating the waste toner container needs to be replaced Otherwise your printer stops printing To replace the waste toner container A CAUTION Do not tilt or turn over the container 1 Turn the printer off then wait a few minutes for the printer to cool 5 Take a new waste toner container out of its package 2 Open the front cover 6 Insert the new container into position and then push it to make sure that it is firmly seated in place 3 Pull the waste toner container out of the printer using its handle NOTE Make sure that you lay the waste toner container on a flat surface so that the toner does not spill CAUTION If the front cover is not completely closed the printer will not operate 8 Turn the printer on 5 6 Supplies and maintenance items 4 Extend the top handle on the imaging unit and then use it to pull the imaging unit out of the printer completely Cleaning the Printer During the printing process particles of paper toner and dust can accumulate inside t
25. the paper length guide and slide it out to its full length 2 Load print material in the tray with the print side up and the short edge first Adjust the guides to fit the length and width of the material NOTE If you experience jams with card stock feeding turn the paper around and try again 3 When you print set the paper source to Manual Feed and select the appropriate size and type in the software application For details see the Software Section If the size of your print material is not listed in the Size box in the Paper tab click the Custom button and set the size manually 4 Press the 9 B button on the printer to start feeding 3 5 Using Print Materials Basic Printing This chapter explains common printing tasks e Printing a Document e Canceling a Print Job 4 1 Basic Printing Printing a Document This printer allows you to print from various Windows applications a Macintosh computer or a Linux system The exact steps for printing a document may vary depending on the application you use For details about printing see the Software Section Canceling a Print Job If the print job is waiting in a print queue or print spooler such as the printer group in Windows delete the job as follows 1 Click the Windows Start button 2 For Windows 98 NT 4 0 2000 Me select Settings and then Printers For Windows XP 2003 select Printers and Faxes 3 Double click the Xerox Phase
26. the printer 6 Close the top cover Make sure that it is securely closed If you cannot find the jammed paper or if there is any resistance removing the paper stop pulling and go to the next step NOTE If the paper tears make sure that all of the paper fragments are removed from the printer I 7 Open and then close the rear cover or front cover to resume printing 4 Close the rear cover and then open the top cover 6 4 Solving Problems Tips for Avoiding Paper Jams Solving Print Quality Problems By selecting the correct paper types most paper jams can be avoided If a paper jam occurs follow the steps outlined in Clearing Paper Jams on page 6 3 Dirt inside of the printer or improper paper loading may reduce print quality See the table below to troubleshoot problems Problem Solution Light or faded If a vertical white streak or faded area appears on the print page e The toner supply is low You may be able to temporarily extend the toner cartridge life See Redistributing Toner on page 5 2 If this does not improve print quality install a new toner cartridge e The paper may not meet paper specifications for example the paper is too moist or too rough See Paper Specifications on page 8 1 e A combination of faded or smeared defects may indicate that the printer needs cleaning See page 5 7 e Follow the procedures on page 3 2 Ensure that the adjustable guides are p
27. works with humidity to damage paper Heat causes the moisture in paper to evaporate while cold causes it to condense on the sheets Heating systems and air conditioners remove most of the humidity from a room As paper is opened and used it loses moisture causing streaks and smudging Humid weather or water coolers can cause the humidity to increase in a room As paper is opened and used it absorbs any excess moisture causing light print and dropouts Also as paper loses and gains moisture it can become distorted This can cause paper jams Care should be taken not to purchase more paper than can be used in a short time about 3 months Paper stored for long periods may experience heat and moisture extremes which can cause damage Planning is important to prevent damage to large supplies of paper Unopened paper in sealed reams can remain stable for several months before use Opened packages of paper have more potential for environmental damage especially if they are not wrapped with a moisture proof barrier The paper storage environment should be properly maintained to ensure optimum printer performance The required condition is 20 to 24 C 68 to 75 F with a relative humidity of 45 to 55 The following guidelines should be considered when evaluating the paper s storage environment e Paper should be stored at or near room temperature e The air should not be too dry or too humid e The best way to store an opened rea
28. 98 Me NT 4 0 2000 2003 XP Windows NT 4 0 is only supported on the Phaser 6110N e Your printer is compatible with Macintosh and various Linux OS e Your printer comes with a USB interface e The Phaser 6110N comes with a built in Network interface 10 100 Base TX The Phaser 6110 does not support a network interface Rear View Printer Components These are the main components of your printer Note that all illustrations on this User s Guide are from the Phaser 6110N Rear Cover and that some parts may be different from your printer Open to clear paper jams Front View Output Tray Face down Top Cover gt Open to clear Output S j A SS paper jams Front Cover Open to access the toner cartridges and USB Port Power Receptacle Only the Phaser 6110N comes with a network port Toner Cartridges Tray Control Panel Handle 150 sheet See 1 3 Use to lift paper feeder the printer NOTE The surface of the output tray may become hot if you print a large number of pages at once Please make sure that you don t touch the surface and prevent children from approaching it 1 2 Introduction Status Toner Understanding the Control Panel LED L Hi LEDs DE lights red each LED e The each toner cartridge is lights red totally exhausted e The each toner cartridge is wrong Toner LEDs OD OD O OB lights red each LED e The each toner cart
29. An unknown image repetitively appears on a next few sheets or loose toner light print or contamination OCCUIS You printer is probably being used at an altitude of 2 500 m 8 200 ft or above The high altitude may affect the print quality such as loose toner or light imaging You can set this option through Printer Settings Utility or Printer Tab in printer driver s properties Refer to the Software Section for detail Solving Problems Troubleshooting Error Messages When the printer experiences an error the control panel will indicate an error message with the indicator lights and the Status Monitor program window will display to show the printer s status or errors Find the light pattern below that matches the printer light pattern and follow the solutions to clear the error LED status legend A v symbol for green light on lt Symbol for red light blinking 4 aa f S o lt bass e symbol for red light on A v O symbol for light off LED pattern Possible Problem and Solution The blinking toner cartridge is low Order a new toner cartridge You can temporarily improve print quality by redistributing the toner See Redistributing Toner on 0909020 Zz gt O page 5 2 Bi The lighting toner cartridge is empty EE Remove the old toner cartridge and install a OBO OB new one See Replacing Toner Cartridges on page 5 3 e The lighting toner c
30. BbCc that it also occurs on a demo page See page 2 7 ed For service contact a service representative aB c Page skew e Ensure that the paper is loaded properly a 4 e Check the paper type and quality See Paper AaBbCo Specifications on page 8 1 AaBbCc Ensure that the paper or other material is loaded AaBbc correctly and the guides are not too tight or too AaBbC C loose against the paper stack C AaBbC C Curl or wave e Ensure that the paper is loaded properly e Check the paper type and quality Both high AaBpCC temperature and high humidity can cause paper A bCC curl See Paper Specifications on page 8 1 aB e Turn the stack of paper over in the tray Also try anos rotating the paper 180 in the tray aB AaBbCC a Wrinkles or creases AaBbCc Ensure that the paper is loaded properly Check the paper type and quality See Paper Specifications on page 8 1 Turn the stack of paper over in the tray Also try rotating the paper 180 in the tray Solving Problems Problem Back of printouts are dirty Solution e Check for leaking toner Clean the inside of the printer See Cleaning the Inside of the Printer on page 5 7 Solid Colour or Black pages e The toner cartridge may not be installed properly Remove the toner cartridge and reinsert e The toner cartridge may be defective and need replacing Install a new toner cartridge e The printer may r
31. E AE N E E 1 3 2 Setting Up Your Printer UNPACKING uu uu 2 1 Installing the Toner Cartridges aiii a ia 2 2 Loading Paper m 2 3 Changing the Size of the Paper in the Tray ccococcoccncncnncnnnnnencnnnnnonnnnnnnrnrenencrnnrnrnnenernrnrenennrannn 2 5 Connecting a Printer Cable iate ici ra AA ARA REA RAR DARA 2 6 For Local Printing e 2 6 For Network Printing Phaser 6110N only esses mmn nennen 2 6 TUNING th Printer On T 2 7 Printing a Demo Page sisesed DE 2 7 Installing the Printer SoftWare Qu aaa AAA can ARA A 2 7 System Requirements exista cies 2 8 Printer Driver Features iio A e 2 8 3 Using Print Materials Choosing Paper and Other Materials sess eene meme enne ne nennen nennen 3 1 Typ and Capacities ccs ses a tad ee a site 3 1 Guidelines for Paper and Special Materials sise 3 1 Verifying the Output Location iii A fa eeu RE Sera 3 2 Loading PADEL isis cost EYES ERRRYRIYAR AREEN EEEE AEAEE TRRPIRER INR RP nie REE tentant 3 2 USING the Er 3 2 Using Manual Feed Mode err a da RENE GUY 3 2 Printing on Special Print Materials lseeseesesesieees nennen nnne nena coran in nu nua sna su Ea iaa puyaqa qami 3 3 Printing on EnvelopGs sus cian a RES anne 3 3 Printing ON Labels necia inci peces nina su ke n ERR RR due dass RE dp REFERENT REIR 3 3 Printing ori Transparericle
32. Gibraltar Hungary India Lativia Lithuania Malta Mexico Middle East Morocco Nigeria Oman Pakistan Paraguay Peru Poland rest of Africa rest of South America Romania Russia CIS Slovakia Slovenia South Africa Sri Lanka Tunisia Turkey Ukraine Uruguay Venezuela Region List B Austria Belgium Canada Denmark Finland France Germany Greece Ireland Italy Netherlands Norway Portugal Puerto Rico Spain Sweden Switzerland UK USA rest of Benelex region To purchase replacement parts contact your Xerox dealer or the retailer where you bought your printer We strongly recommend that items be installed by a trained service professional except for the toner cartridges see 5 3 the imaging unit see 5 4 and the waste toner container see 5 6 If you use refilled toner cartridges print quality may be reduced Supplies and maintenance items Managing Toner Cartridges Toner Cartridge Storage To get the maximum results from a toner cartridge keep the following guidelines in mind Do not remove toner cartridges from their packages until you are ready to use them e Do not refill toner cartridges The printer warranty does not cover damage caused by using a refilled cartridge e Store toner cartridges in the same environment as the printer To prevent damage to toner cartridges do not expose them to light for more than a few minutes Toner Cartridge Life Expectancy The life of a to
33. Help sisi nene nennen se a aka qaqa sees serene nere 16 Opening the Troubleshooting Guide sess mene nemen mene ee senem nnne 16 Changing the Status Monitor Program Settings issues 16 Chapter 7 USING YOUR PRINTER IN LINUX System Requirements uy u wu sante sen anna uu eee on needs ste en need edit ice 17 Installing the Printer Driver iia ana 18 Changing the Printer Connection Method issus 19 Uninstalling the Printer Driver 4 sais sages aasan ana awia akana a li 20 Using the Configuration Tool 44 meme na eese enn nennen 20 Changing LEPR Properties 2 peak eese Set ue x Exp EY datada 21 Chapter 8 USING YOUR PRINTER WITH A MACINTOSH Installing Software for Macintosh sssssssssssssssssene semen ee enemies ee nih eme tene ne nee ne nene enn 22 Setting Up dui IHI T 23 For a Network connected Macintosh s s essesssrssrsrsrrnrsrrnrntrnrn trutu nr seems nemen ennemi nenne 23 For a USB connected Macintosh sse semen sementem ene ene 23 Cadm mmm 24 Printing Document siii ex he ko ken pax A EXFUEERR VERRE UETKE 24 Changing Printer Settings uuu a sinh pasqa sqa qupa ESA A AEA waqsa bia 24 Printing Multiple Pages on One Sheet of Paper iii 25 1 Installing Printer Removing Software Software in Windows i atat Windows 2 From the Start menu select Programs or All Programs gt Xerox Phaser 6110 Maintenance 3 You will see a component list so that you can
34. N AENEA ENEE EAA DEEE KEE EAI TAIN ENE EOR REDERIER ENE 8 3 le c LET 8 4 Important Precautions and Safety Information When using this machine these basic safety precautions should always be followed to reduce risk of fire electric shock and injury to people 1 Read and understand all instructions 2 Use common sense whenever operating electrical appliances 3 Follow all warnings and instructions marked on the machine and in the literature accompanying the machine 4 Ifan operating instruction appears to conflict with safety information heed the safety information You may have misunderstood the operating instruction If you cannot resolve the conflict contact your sales or service representative for assistance 5 Unplug the machine from the AC wall socket before cleaning Do not use liquid or aerosol cleaners Use only a damp cloth for cleaning 6 Do not place the machine on an unstable cart stand or table It may fall causing serious damage 7 Your machine should never be placed on near or over a radiator heater air conditioner or ventilation duct 8 Do notallow anything to rest on the power Do not locate your machine where the cords will be abused by persons walking on them 9 Do not overload wall outlets and extension cords This can diminish performance and may result in the risk of fire or electric shock 10 Do not allow pets to chew on the AC power or PC interface cords 11 Never push objects of any kind into t
35. NDO SE ABRE EVITAR EXPONERSE AL RAYO RADIA O LASER INVIS VEL AO ABRIR EVITE EXPOSIC O DIRECTA AO FEIXE ONZICHTBARE LASERSTRALEN BIJ GEOPENDE KLEP DEZE KLEP NIET OPENEN USYNLIG LASERSTRALNING VED BNING UNDGA UDSAETTELSE FOR STRALNING ADVARSEL USYNLIG LASERSTRALNING NAR DEKSEL PNES UNNG EKSPONERING FOR STRALEN VARNING OSYNLIG LASERSTR LNING N R DENNA DEL R PPEN STR LEN R FARLIG VAROITUS N KYM T NT LASERS TEILY AVATTAESSA VARO SUORAA ALTISTUMISTA S TEELLE BES DEBI o HS eio aozo LE Saz FAKAS DANGER VORSICHT ATTENZIONE PRECAUCI N PERIGO GEVAAR ADVARSEL Ozone Safety During normal operation this machine produces ozone The ozone produced does not present a hazard to the operator However it is advisable that the machine be operated in a well ventilated area If you need additional information about ozone please contact your nearest Xerox dealer Power Saver This printer contains advanced energy conservation technology that reduces power consumption when it is not in active use When the printer does not receive data for an extended period of time power consumption is automatically lowered Recycling er Correct Disposal of This Product Waste Electrical amp Electronic Equipment Please recycle or dispose of packaging materials for this product in an environmentally responsible manner Applicable in t
36. Phaser 6110 Series Colour laser printer User Guide Guide D utilisation Benutzerhandbuch Guida dell utente Gu a del usuario Guia do Usu rio Gebruikershandleiding PyKOBOJICTBO MONb30BaTena Przewodnik uzytkownika Felhaszn l i tmutat U ivatelsk p ru ka Kullan m K lavuzu Brugervejledning O ny c xp on Brukerh ndbok Kayttopas Anvandarhandbok www xerox com office support XEROX This manual is provided for information purposes only All information included herein is subject to change without notice Xerox Corporation is not responsible for any direct indirect or other damage arising from or related to use of this manual 2006 Xerox Corporation All rights reserved e Phaser 6110 and Phaser 6110N are model names of Xerox Corporation e Xerox and Xerox logo are trademarks of Xerox Corporation e Apple TrueType Laser Writer and Macintosh are Trademarks of Apple Computer Inc Microsoft Windows Windows 98 Windows Me Windows 2000 Windows 2003 Windows NT 4 0 and Windows XP are registered trademarks of Microsoft Corporation e All other brand or product names are trademarks of their respective companies or organizations CONTENTS 1 Introduction Special zzzi ge n 1 1 Printer Components issue ni 1 2 FOIE WAGWe M M EET 1 2 Reat VIEW pvc a a a a a a A O 1 2 Understanding the Control Panel conocia oi is coa ER LH en ea a SA sut ae eee ae ea NO EE ne ca a ma dent aa Le A censuum EA E EAE
37. Sciences Canada Declaration of Conformity European Countries Approvals and Certifications CE January 1 1995 Council Directive 73 23 EEC Approximation of the laws of the member states related to low voltage equipment January 1 1996 Council Directive 89 336 EEC 92 31 EEC approximation of the laws of the Member States related to electromagnetic compatibility March 9 1999 Council Directive 1999 5 EC on radio equipment and telecommunications terminal equipment and the mutual recognition of their conformity A full declaration defining the relevant Directives and referenced standards can be obtained from your Xerox Corporation representative The CE marking applied to this product symbolises Xerox Corporation Declaration of Conformity with the following applicable 93 68 EEC Directives of the European Union as of the dates indicated Replacing the Fitted Plug for UK Only IMPORTANT The mains lead for this machine is fitted with a standard BS 1363 13 amp plug and has a 13 amp fuse When you change or examine the fuse you must re fit the correct 13 amp fuse You then need to replace the fuse cover If you have lost the fuse cover do not use the plug until you have another fuse cover Please contact the people from you purchased the machine The 13 amp plug is the most widely used type in the UK and should be suitable However some buildings mainly old ones do not have normal 13 amp plug sockets You need to buy a
38. TE The Overlay feature is not supported in NT 4 0 Creating a New Page Overlay To use a page overlay you must create a new page overlay containing your logo or image 1 U U N NO Create or open a document containing text or an image for use in a new page overlay Position the items exactly as you wish them to appear when printed as an overlay To save the document as an overlay access printer properties See Printing a Document on page 5 Click the Extras tab and click Edit button in the Overlay section In the Edit Overlay window click Create Overlay In the Create Overlay window type a name in the File name box Select the destination path if necessary The default is C Formover Click Save The name appears on the Overlay List box Click OK or Yes to finish creating The file is not printed Instead it is stored on your computer hard disk drive NOTE The overlay document size must be the same as the documents you print with the overlay Do not create an overlay with a watermark Advanced Printing 14 Using a Page Overlay After an overlay has been created it is ready to be printed with your document To print an overlay with a document 1 2 Create or open the document you want to print To change the print settings from your software application access printer properties See Printing a Document on page 5 Click the Extras tab Select the desired overlay from the Overlay
39. Type Local Description Location State Idle Language Device Model Go to the Web page for this printer rint E Due Using Your Printer in Linux 19 Changing the Printer Connection Method If you change the printer connection method from USB to Networkl or vice versa while in use you must reconfigure your Linux printer by adding the printer to your system Take the following steps 1 Make sure that you connect the printer to your computer Turn both the computer and the printer on 2 When the Administrator Login window appears type in root in the Login field and enter the system password NOTE You must log in as a super user root to install a new printer to the printing system If you are not a super user ask your system administrator 3 From the Startup Menu icon at the bottom of the desktop select Linux Printer and then Configuration Tool You can also access the Linux Printer Configuration window by typing in linux config from the Terminal screen 4 When the Linux Printer Configuration window appears click the Add Printer icon on the toolbar at the top of the window 5 Click the Connection tab at the top of the Add a Printer window Ensure that the printer port is set properly If it is not change the device setting Connection USB Settings Device idev usb Ipo 6 Click OK Uninstalling the Printer Driver 1 From
40. Vertical lines If black vertical streaks appear on the page I e A imaging unit has probably been scratched AaBbC Remove the imaging unit and install a new one See AaBbC page 5 3 AaBbC If white vertical lines appear on the page AaBbCca ae e ue of the tora ds nside of the Printer on page 5 7 If you still have AaBbCc the same problems replace the imaging unit with a new one See page 5 3 Colour or If the amount of background shading becomes Black unacceptable the procedures below may fix the background problem e Change to lighter weight paper See Paper AaBbCc Specifications on page 8 1 AaBbCc e Check the printer s environment very dry low humidity or high humidity higher than 80 RH AaBbCc conditions can increase the amount of background AaBbCc shading AaBbCc e Remove one of the old toner cartridges and install a new one Toner smear Clean the inside of the printer See Cleaning the Inside of the Printer on page 5 7 AaBbCc Check the paper type and quality See Paper AaBbCc Specifications on page 8 1 e Remove the imaging unit and install a new one See AaBhC de a C Replacing the Imaging Unit on page 5 4 AaBbCc AaBbCc Vertical If marks repeatedly appear on the printed side of the repetitive page at even intervals defects e Clean the inside of the printer See Cleaning the Inside of the Printer on page 5 7 After cleaning AaBbCc t
41. Windows 3 W watermark create 13 delete 13 edit 13 print 13 27 Rev 1 01
42. aasneneeaereees 5 7 6 Solving Problems Troubleshooting Checklist coincidir Foret ku repone acp add 6 1 Solving General Printing Problems sise aaa rr 6 2 Cl aring Paper Jam S e 6 3 Tips for Avoiding Paper JAMS iin sense serate eet a cepa pasara RP KERREN 6 5 Solving Print Quality Problems uuu uuu a ass Py ERR RA ters AR usa AG tease ets 6 5 Troubleshooting Error Messages soceri ient pai cesa Rasa edad a RM RR Dea i desde 6 8 LED Status legend cm 6 8 Common Windows Problems ss irradia 6 8 Common Macintosh Problems siii iia lb dai sine 6 8 Common Linux Problems sri 22 cnin pna a a A AA AR 6 9 7 Using Your Printer on a Network About Sharing the Printer on a Network 44424242 asas assqa a 7 1 Setting Up a Network Connected Printer Phaser 6110N only essem 7 1 8 Specifications Printer Specifications uuu aaa Dekor ds 8 1 Paper Specifications sica tue rk ERR ERE kas panas RB RISE RA AR KRS NR s A QS RR XR ENE NEN TRR2 R qasqawawa 8 1 OVErVIEW c 8 1 Supported Sizes Of Paper error nettement di 8 2 Guidelines for USING Paper kuu crece rene tenent hex eter on Aia ENE ttes quia adag dad Syawawakaqhuwsykaakias 8 2 Paper Specifications NR 8 3 Paper Output Capacity maca da ETEA SE Exe ERI 8 3 Paper Input Capacity ME D t 8 3 Printer and Paper Storage Environment sss nemen mene mene nnne nennen 8 3 EriVelopeS PC e E POE E Nna EEn E PANEO EEE
43. ackage that enables that feature The smbclient command should be available and usable on your system My application seems to be frozen while LLPR is running Most Unix applications will expect a command like the regular Ipr command to be non interactive and thus return immediately Since LLPR is waiting for user input before passing the job on to the print spooler very often the application will wait for the process to return and thus will appear to be frozen its windows won t refresh This is normal and the application should resume functioning correctly after the user exits LLPR How do I specify the IP address of my SMB server It can be specified in the Add Printer dialogue of the configuration tool if you don t use the CUPS printing system Unfortunately CUPS currently doesn t allow you to specify the IP address of SMB printers so you will have to be able to browse the resource with SAMBA in order to be able to print Some documents come out as white pages when printing Some versions of CUPS especially those shipped with Mandrake Linux before the 8 1 release have some known bugs when processing PostScript output from some applications Try upgrading to the latest version of CUPS at least 1 1 14 Some RPM packages for the most popular distributions are provided as a convenience with this Linux Printing Package I have CUPS and some options such as N up seem to be always enabled even
44. ailable for the selected printer appear at the top of the the install path or printing system Add a Printer window 5 If you selected Recommended go to step 6 NOTE If the printer supports PS printing it is recommended to select the PS driver 18 Using Your Printer in Linux 9 Click the Connection tab and ensure that the printer port is set properly If it is not change the device setting Settings Device dev usb lpO I 10 vou can use the Settings tab and the Queue tab to view the printer s current settings If necessary you can change the settings NOTE Options may differ depending on the printer in use The Description and the Location field in the Queue screen may not appear depending on the printing system in use 11 To exit click OK 12 When the window indicates that the new printer is successfully configured click OK 13 The Linux Printer Configuration window reappears From the Info tab you can view information about your printer driver If necessary you can change the printer s configuration For details about changing the printer s configuration see Using the Configuration Tool on page 20 K Linux Printer Confiquration File Print Printer Help E LA D Add Printer Remove Suspend Resume Printer Status Info Jobs Properties E Linux Printers Information for printer Ip Other Printers
45. al Printing Problems For problems with the operation of your printer refer to the table for suggested solutions Solution Check the power cord connections Check the power switch and the power source The printer is not selected as the default printer Select Xerox Phaser 6110 Series as your default printer Check the printer for the following e The printer cover is not closed e Paper is jammed e No paper is loaded e A toner cartridge is not installed After locating the problem clear it If a printer system error occurs contact your service representative e Close the printer cover e Clear the paper jam See 6 3 e Load paper See 2 3 e Install the toner cartridge See 5 3 The printer may be in manual feed mode and out of paper Check the message on the Status Monitor program window add paper to the tray and press the 9 8 button on the control panel The connection cable between the computer and the printer is not connected properly Disconnect the printer cable and reconnect it The connection cable between the computer and the printer is defective If possible attach the cable to another computer that is working properly and try to print a document You can also try using a different printer cable The port setting is incorrect Check the Windows printer setting to make sure that the print job is sent to the correct port If the computer has mor
46. artridge is totally exhausted Remove the old toner cartridge and install a new one See Replacing Toner Cartridges on page 5 3 e The lighting toner cartridge is wrong Only install a Xerox toner cartridge designed for your printer e A paper jam has occurred To solve the problem see Clearing Paper Jams on page 6 3 e The front or top cover is opened Close the front or top cover e There is no paper in the tray Load paper in the tray e The waste toner container is not installated or full Check the container e Your system has some problems If this problem occurs contact your service representative 6 8 Common Windows Problems Problem Possible Cause and Solution File in Use message appears during installation Exit all software applications Remove all software from the StartUp Group then restart Windows Reinstall the printer driver General Protection Fault Exception OE Spool32 or Illegal Operation messages appear Close all other applications reboot Windows and try printing again Fail To Print A printer timeout error occurred messages appear These messages may appear during printing Just keep waiting until the printer finishes printing If the message appears in standby mode or after printing has been completed check the connection and or whether an error has occurred The printer does not print PDF file correctly Some
47. atus Monitor program window will appear on the computer indicating which item needs to be replaced 5 1 See below See Item s Pages Printed Part number Page Black toner Approx 2 000 pages Region List A 5 3 cartridge 106R01203 Region List B 106R01274 Colour toner Approx 1 000 pages Region List A 5 3 cartridges 106R01206 Cyan 106R01205 Magenta 106R01204 Yellow Region List B 106R01271 Cyan 106R01272 Magenta 106R01273 Yellow Imaging unit Approx 20 000 black Region List A 5 4 pages or approx 50 000 108R00721 images Region List B 108R00744 Waste toner Approx 5 000 images 108R00722 5 6 container or Approx 1 250 pages fulll colour 5 image Pick up roller Approx 50 000 pages Fuser unit Approx 100 000 black pages or 50 000 colour pages Contact a service representative T2 roller Approx 100 000 pages ITB Approx 60 000 images Average A4 letter sized page count based on 5 coverage of individual colours on each page Usage conditions and print patterns may cause results to vary Image counts based on one colour on each page If you print documents in full colour Cyan Magenta Yellow Black the life of this item will be reduced by 25 Region List A Algeria Argentina Bulgaria Bermuda Brazil Caribbean excluding Puerto Rico and the US Virgin Islands Central America Chile Colombia Czech Republic Croatia Cyprus Ecuador Egypt Estonia
48. ch colour toner cartridge is lights red empty 1 3 Introduction CAUTION Because your printer weighs 13 6 kg including the Setti n g U D Yo u r P ri nte r AN toner cartridges and the tray it may move when you use it for example when opening closing the tray or installing removing This chapter gives you step by step instructions for setting up the toner cartridge Be careful not to move the printer your printer This chapter includes 2 Remove the packing tape in front of the tray and pull the i tray out Remove the packing tape and paper cushion from e Unpacking I the tray e Installing the Toner Cartridges e Loading Paper e Connecting a Printer Cable e Turning the Printer On e Printing a Demo Page I e Installing the Printer Software Unpacking 3 Select a location for the printer 1 Remove the printer and all of the accessories from the e Leave enough room to open the tray and covers and to packing carton Make sure that the printer has been allow for proper ventilation k ith the following it a packed A a e Provide the proper environment A firm level surface Away from the direct airflow of air conditioners heaters or ventilators Free of temperature sunlight and humidity extremes or fluctuations Clean dry and free of dust Toner Cartridges Power Cord u Printer software CD Quick Install Guide NOTES e If any items are missing or dama
49. ction 6 Press the e amp button on the printer to start feeding 3 3 Using Print Materials Printing on Labels Only use labels recommended for your printer Verify that the labels adhesive material can tolerate a fusing temperature of 180 C 356 F for 0 1 seconds Make sure that there is no exposed adhesive material between the labels Exposed areas can cause labels to peel off during printing which can cause paper jams Exposed adhesive can also cause damage to printer components Never print on the same sheet of labels more than once or print on a partial sheet of labels Do not use labels that are separating from the backing sheet or are wrinkled or damaged in any way To prevent labels from sticking together do not let the printed label sheets stack up as they are printed out To print on label 1 2 4 Squeeze the paper length guide and slide it out to its full length Load a sheet of label in the tray with the print side up and the top short edge in first Adjust the guides to fit the length and width of the label When you print set the paper source to Manual Feed and the paper type to Labels and select the appropriate size in the software application For details see the Software Section Press the e l button on the printer to start feeding Printing on Transparencies Place them on a flat surface after removing them from the machine e Do not leave them in the tray for l
50. diate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures eReorient or relocate the receiving antenna eIncrease the separation between the equipment and receiver eConnect the equipment into an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help CAUTION Changes or modifications not expressly approved by the manufacturer responsible for compliance could void the user s authority to operate the equipment Canadian Radio Interference Regulations This digital apparatus does not exceed the Class B limits for radio noise emissions from digital apparatus as set out in the interference causing equipment standard entitled Digital Apparatus ICES 003 of the Industry and Science Canada Cet appareil num rique respecte les limites de bruits radio lectriques applicables aux appareils num riques de Classe B prescrites dans la norme sur le mat riel brouilleur Appareils Num riques ICES 003 dict e par l Industrie et
51. e Long Edge which is the conventional layout used in book binding Short Edge which is the type often used with calendars m IN eal TTT gt iil Long Edge o 2 o TY m a a oO NOTE e Do not print on both sides of labels transparencies envelopes or thick paper Paper jamming and damage to the printer may result To use double sided printing you can use only the following paper sizes A4 Letter Legal and Folio with a weight of 20724 Ibs 75 90 g m 1 To change the print settings from your software application access printer properties Printing a Document on page 5 From the Layout tab select the paper orientation From the Double sided Printing Manual section select the binding option you want Click the Paper tab and select the paper source size and type Click OK and print the document Uu UN NOTE If your printer does not have a duplex unit you should complete the printing job manually The printer prints every other page of the document first After printing the first side of your job the Printing Tip window appears Follow the on screen instructions to complete the printing job 12 1 T l Advanced Printing Printing a Reduced or Enlarged Document You can change the size of a page
52. e Section 2 4 Setting Up Your Printer Changing the Size of the Paper in the Tray To change the tray size to other size you must adjust the paper length guide properly 1 Pullthe tray out of the printer Open the paper cover and remove paper from the tray if necessary 2 Pressing and unlatching the guide lock in the top of the tray pull the tray out manually Setting Up Your Printer 2 5 4 Slide the paper length guide until it lightly touches the end of the paper stack Squeeze the paper width guide and slide it to the edge of the paper stack without causing it to bend For paper smaller than Letter sized return the paper guides to their original positions and adjust the paper length guide and paper width guide NOTES Do not push the width guide far enough to cause the material to warp e If you do not correctly adjust the width guide it may cause a paper jam Y XX X 1 5 Close the paper cover 6 Slide the tray back into the printer Connecting a Printer Cable For Local Printing To print from your computer in a local environment you need to connect your printer to the computer with a Universal Serial Bus USB cable NOTE Connecting the printer to the USB port of the computer requires a certified USB cable You will need to buy a USB 2 0 compliant cable that is not longer than 3 m 1 Make sure that both the printer and th
53. e SetIP program Supported Operating Systems NOTE The operating systems supported by the network card may be different than the operating systems supported by the printer The following table shows the network environments supported by the printer Item Requirements Network Interface Ethernet 10 100 Base TX standard Network Operating System e Windows 98 Me NT 4 0 2000 2003 XP e Various Linux OS e Macintosh OS 10 3 10 4 Network Protocols e TCP IP on Windows e IPP SNMP Dynamic Addressing Server DHCP BOOTP e TCP IP Transmission Control Protocol Internet Protocol DHCP Dynamic Host Configuration Protocol BOOTP Bootstrap Protocol Using Your Printer on a Network Specifications and Description 8 Specifications This chapter includes Operating Temperature 50 90 F 10 32 5 C RIDIFGHIREDE Humidity 20 80 RH Printer language GDI e Printer Specifications Se es Memory Phaser 6110 32 MB non expandable e Paper Specifications Phaser 6110N 64 MB non expandable Interface Phaser 6110 USB 2 0 P t S ifi ti Phaser 6110N USB 2 0 Ethernet 10 100 Base TX rinter peci Ications OS Windows 98 Me NT 4 0 2000 XP 2003 Various Linux compatibility OS Mac OS 10 3 10 4 Item Specifications and Description Print speed Black and white Up to 16 PPM in A4 17 PPM in Letter Windows NT 4 0 is only supported on the Phaser
54. e TX network interface card NOTE Some printers do not support a network I interface Make sure that your printer supports a network interface by referring to Printer Specifications in your Printer User s Guide This chapter includes The Phaser 6110 Installer window opens Click Continue e Installing Software for Macintosh and then click Continue w On OU E w N Select Easy Install and click Install 10 After the installation is finished click Quit e Setting Up the Printer e Printing Uninstalling the Printer driver a H Uninstall is required if you are upgrading the software or if Installing Software for Macintosh A HOO ie The Printer software CD that came with your printer provides 1 Insert the Printer software CD which came with your you with the PPD file that allows you to use the CUPS driver for printer into the CD ROM drive printing on a Macintosh computer 2 Double click CD ROM icon that appears on your Verify the following before you install the printer software Macintosh desktop Item Er 3 Double click the MAC_ Installer folder 4 Double click the MAC Printer folder Operating System Mac OS 10 3 10 4 5 Double click the Phaser 6110 Installer icon RAM 128 MB 6 Enter the password and click OK Free Disk Space 200 MB 7 The Phaser 6110 Installer window opens Click Continue and then click Continue 8 Select Uninstall and then click Uninstall 9 when the uninstallation is done clic
55. e computer are turned off 2 Plug the USB cable into the connector on the rear of the printer 3 Connectthe other end of the cable to the USB port on your computer NOTE To print using the USB interface you must run Windows 98 Me 2000 2003 XP or Macintosh with OS 10 3 10 4 Setting Up Your Printer 2 6 For Network Printing Phaser 6110N only You can attach your printer to a network using an Ethernet cable UTP cable with RJ 45 connector The Phaser 6110N has a built in network interface card 1 Make sure that both the printer and the computer are turned off 2 Plug one end of the Ethernet cable into the Ethernet network port on the rear of the printer To the network LAN connection 3 Plug the other end of the cable into a network LAN connection NOTE After connecting the printer you need to configure the network parameters using the software supplied with the printer A A Turning the Printer On 1 Plug the power cord into the power receptacle on the rear of the printer 2 Plug the other end into a properly grounded AC outlet and turn on the power CAUTION If there is a cracking sound re install the imaging unit The imaging unit is not properly installed CAUTION e Some parts inside the printer may be hot when power is on or after printing Be careful not to burn yourself when working inside the printer e Do not disassemble the pr
56. e list Using an Existing Watermark 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 2 Click the Extras tab and select the desired watermark from the Watermark drop down list You will see the selected watermark in the preview image 3 Click OK and start printing NOTE The preview image shows how the page will look when it is printed Creating a Watermark 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 2 Click the Extras tab and click the Edit button in the Watermark section The Edit Watermark window appears 3 Enter a text message in the Watermark Message box You can enter up to 40 characters The message displays in the preview window When the First Page Only box is checked the watermark prints on the first page only 4 Select watermark options You can select the font name style size or grayscale level from the Font Attributes section and set the angle of the watermark from the Message Angle section 5 Click Add to add a new watermark to the list 6 When you have finished editing click OK and start printing To stop printing the watermark select No Watermark gt from the Watermark drop down list Advanced Printing 13 Editing a Watermark 1 To change the print settings from your software application access printer properties See Print
57. e than one port make sure that the printer is attached to the correct one The printer may be configured incorrectly Check the printer properties to ensure that all of the print settings are correct 6 2 Problem The printer does not print continued Possible Cause The printer driver may be incorrectly installed Solution Reinstall the printer driver see the Software Section Try printing a test page The printer is malfunctioning Check the LEDs on the control panel to determine if the printer is indicating a system error The document size is so big that the hard disk space of the computer is not enough to access the print job Get more hard disk space and print the document again Paper does Paper has been Remove paper from the tray and not feed into loaded incorrectly reload it correctly the printer Check that the paper guides are set correctly There is too much Remove excess paper from the tray paper in the tray The paper is too Use only paper that meets printer thick specifications Aprintjobis The job may be very Reduce the complexity of the extremely complex page s or try adjusting the print slow quality settings Adjust the print quality settings such as reducing the resolution If you have set the resolution to Best change it to Normal or Draft See the Software section Your printer prints A4 sized paper at 16 ppm in
58. een Help For more information about Printer Settings Utility click Q Display when job is finished for network printer shows the Status Monitor balloon when your job is complete e Display when error occurs during printing shows the Status Monitor balloon when an error occurs during printing e Schedule an automatic status checking every allows the computer to update the printer status regularly Setting the value close to 1 second causes the computer to check the printer status more frequently thereby allowing a faster response to any printer error NOTE When the Status Monitor balloon appears to indicate an error you can cancel the current print job or view the corresponding solution If you select Cancel Printing turn the printer off and then click OK It may take several minutes Note that data which is being sent to the printer via the network will be lost 16 Using Utility Applications Using Your Printer in Linux You can use your printer in a Linux environment This chapter includes e System Requirements e Installing the Printer Driver e Changing the Printer Connection Method e Uninstalling the Printer Driver e Using the Configuration Tool e Changing LLPR Properties 17 Using Your Printer in Linux System Requirements Supported OS e Red Hat 8 0 9 0 e Fedora Core 1 2 3 e Mandrake 9 2 10 1 e SUSE 8 2 9 2 Recommended Capacities e Pentium IV 1 GHz or high
59. egrees Layout Options Layout Options allows you to select advanced printing options You can choose Multiple Pages per Side Poster and Booklet e For details see Printing Multiple Pages on One Sheet of Paper N Up Printing on page 10 e For details see Printing Posters on page 11 e For details see Printing Booklets on page 11 Double sided Printing Double sided Printing allows you to print on both sides of paper e For details see Printing on Both Sides of Paper on page 12 Paper Tab Use the following options to set the basic paper handling specifications when you access the printer properties See Printing a Document on page 5 for more information on accessing printer properties Click the Paper tab to access various paper properties 5 Xerox Phaser 6110 Printing Preferences CES Layout Paper Graphics Other Features Troubleshooting 1 Copies 1 999 Paper ptions X Size A4 X Custom e Source Auto Select Ed 4 Type Plain Paper X gt Al A4 210 x 297 mm O 21 c E 6 mm C inch caling 5 None Copies 1 y PO Eu Quality Normal Favorites Printer Default NER Copies Copies allows you to choose the number of copies to be printed You can select 1 to 999 copies Size Size allows you to set the size of paper you loaded in the tray If the required size is not listed in the Size box click Custo
60. equire repair Contact a service representative Loose toner AaBb c AaBbCc e Clean the inside of the printer e Check the paper type and quality See Paper Specifications on page 8 1 e Install a new toner cartridge See Replacing Toner Cartridges on page 5 3 e If the problem persists the printer may require repair Contact a service representative Character Character voids are white areas within characters that Voids should be solid black e You may be printing on the wrong surface of the paper Remove the paper and turn it over e The paper may not meet paper specifications See page 8 1 Horizontal If horizontally aligned colour or black streaks or stripes smears appear e A toner cartridge may be installed improperly AaBbCc Remove the toner cartridge and reinsert AaBbCc e A toner cartridge may be defective Install a new AaBbCc toner cartridge haBbCc e If the problem persists the printer may require repair Contact a service representative AaBbCc 6 7 Curl AaBbCc AaBbCc AaBbCc AC Problem Solution If the printed paper is curled or paper does not feed into the printer e Turn the stack of paper over in the tray Also try rotating the paper 180 in the tray e Change the printer option and try again Go to printer properties click Paper tab and set paper type to Thin Refer to the Software Section for details
61. er e RAM 256 MB or higher e HDD 1 GB or higher Software e Glibc 2 1 or higher e GTK 1 2 or higher e GhostScript NOTES e The Linux printer s properties window that appears in this User s Guide may differ depending on the printer in use However the composition of the properties is similar e You can check your printer name in the supplied Printer software CD a For Expert select the desired option and then click Installing the Printer Driver pegin install K Linux Printer Package Setup ru x 1 Make sure that you connect the printer to your computer Global Options Turn both the computer and the printer on Install path ust locallinuxprinter F 2 when the Administrator Login window appears type in gt Link path fusion root in the Login field and enter the system password Install Options Z Common files O Install CUPS 1 1 Printing System 0 CUPS Printing System Q LPRng LPR Printing System A Free space 440 MB Estimated size 6 MB int Startup menu entries KDE Gnome ackage Ready to install Cancel View Readme Begin Install I NOTE You must log in as a super user root to install the printer software If you are not a super user ask your system administrator 3 Insert the Printer software CD The CD ROM automatically runs NOTE If the Printer software CD does not automatical
62. erhead should be sealed in moisture proof wrapping to prevent changes during storage Before you load preprinted paper such as forms and letterhead verify that the ink on the paper is dry During the fusing process wet ink can come off of preprinted paper reducing the print quality To print on preprinted paper 1 2 4 Squeeze the paper length guide and slide it out to its full length Load letterhead in the tray with the print side up and the top and short edge first Adjust the guides to fit the edge of the paper stack When you print set the paper source to Manual Feed and the paper type to Preprinted and select the appropriate paper size in the software application For details see the Software Section Press the El button on the printer to start feeding Printing on Card Stock or Custom sized Materials Postcards 3in by 5in index cards and other custom sized materials can be printed with your printer The minimum size is 3in by 5in 76mm by 127mm and the maximum size is 8 5in by 14in 216mm by 356mm Always insert the short edge into the tray first If you want to print in landscape mode make this selection using your software Inserting these materials long edge first may cause a paper jam Do not print on material smaller than 3in 76mm wide or Sin 127mm long In the software application set margins at least 4mm away from the edges of the material To print on card stock 1 Squeeze
63. erted through CIE colour space Because Postscript uses CIE colour space for Colour Matching System you should upgrade Ghostscript on your system to at least GNU Ghostscript version 7 06 or later You can find recent Ghostscript versions at www ghostscript com The machine does not print The CUPS Common Unix Printing System version distributed with SuSE Linux 9 2 cups 1 1 21 has a problem with ipp Internet Printing Protocol printing Use the socket printing instead of ipp or install later version of CUPS cups 1 1 22 or higher Some color images come out in unexpected color This is a known bug in Ghostscript until GNU Ghostscript version 7 xx when the base colour space of the document is indexed RGB colour space and it is converted through CIE colour space Because Postscript uses CIE color space for Colour Matching System you should upgrade Ghostscript on your system to at least GNU Ghostscript version 8 xx or later You can find recent Ghostscript versions at www ghostscript com The printer does not print PDF file correctly Some parts of graphics text or illustrations are missing Incompatibility between the PDF file and the Acrobat products Printing the PDF file as an image may solve this problem Turn on Print As Image from the Acrobat printing options NOTE It will take longer to print when you print a PDF file as an image Solving Problems Using Your Printer on a Netwo
64. es Number of copies 1 Dear vies Q Odd Pages Collate copies Enter page numbers and or groups of pages to 1 print separated by commas 1 2 5 10 12 17 int ackage fox Cancel He Linux 21 Using Your Printer in Linux You can also open the LLPR Properties window in the following ways eFrom the Startup Menu icon at the bottom of the screen select Linux Printer and then Linux LPR eIf the Linux Printer Configuration window is currently open select Test Print from the Print menu 3 The LLPR Properties window opens v PR Propertie _ x General Margins Image Text HP GL 2 advanced Paper size US Letter m Paper type Plain Paper y Paper source Auto Select Orientation Duplex printing 9 Portrait None O Landscape O Long edge O Reverse landscape O short edge 4 O Reverse portrait Banners Pages per sheet Start none v amp 1 End none v O 2 O4 OK Save Cancel Help l You will see the following six tabs at the top of the window eGeneral allows you to change the paper size the paper type the paper source the orientation of the documents enable the duplex feature add start and end banners and change the number of pages per sheet eMargins allows you to specify the page margins The graphics on the right sh
65. f you select 2x2 the output will be automatically stretched to cover 4 physical pages olan DNS WD FUN NEP A 3x3 Specify an overlap in millimeters or inches to make it easier to pasting the sheets together 0 15 inches thik m QUE Ge DS D 0 15 inches T Click the Paper tab select the paper source size and type Click OK and print the document You can complete the poster by pasting the sheets together Advanced Printing 11 Printing Booklets This printer feature allows you to print your document on both sides of the paper and arranges the pages so that the paper can be folded in half after printing to produce a booklet 1 To change the print settings from your software application access the printer properties See Printing a Document on page 5 2 From the Layout tab choose Booklet Printing from the Type drop down list NOTE The booklet printing option is available when A4 Letter Legal or Folio size is selected in the Size option on the Paper tab 3 Click the Paper tab and select the paper source size and type 4 Click OK and print the document 5 After printing fold and staple the pages Printing on Both Sides of Paper You can print on both sides of a sheet of paper Before printing decide how you want your document oriented The options are Non
66. f you continuously print multiple pages the surface of the output tray may become hot Be careful not to touch the surface and keep children away from the surface 17 SAVE THESE INSTRUCTIONS Laser Safety Statement The printer is certified in the U S to conform to the requirements of DHHS 21 CFR chapter 1 Subchapter J for Class I 1 laser products and elsewhere is certified as a Class I laser product conforming to the requirements of IEC 825 Class I laser products are not considered to be hazardous The laser system and printer are designed so there is never any human access to laser radiation above a Class I level during normal operation user maintenance or prescribed service condition WARNING Never operate or service the printer with the protective cover removed from Laser Scanner assembly The reflected beam although invisible can damage your eyes When using this product these basic safety precautions should always be followed to reduce risk of fire electric shock and injury to persons CAUTION CLASS 3B LASER RADIATION WHEN OPEN AVOID EXPOSURE TO THE BEAM LASER RADIATION AVOID DIRECT EXPOSURE TO BEAM DANGER RADIATIONS INVISIBLES DU LASER EN CAS D OUVERTURE EVITER TOUTE EXPOSITION DIRECTE AU FAISCEAU UNSICHTBARE LASERSTRAHLUNG WENN ABDECKUNG GE FFNET NICHT DEM STRAHL AUSSETZEN RADIAZIONE LASER INVISIBILE IN CASO DI APERTURA EVITARE L ESPOSIZIONE AL FASCIO RADIACI N LASER INVISIBLE CUA
67. ftware CD 6 To start the print job click OK or Print in the Print window If you see Setup Printer or Options in your Print window click it instead Then click Properties on the next The following procedure describes the general steps required for printing from various Windows applications The exact steps for printing a document may vary depending on the application program you are using Refer to the User s Guide of your software application for the exact printing procedure 5 Basic Printing Printer Settings You can use the printer properties window which allows you to access all of the printer options you need when using your printer When the printer properties are displayed you can review and change the settings needed for your print job Your printer properties window may differ depending on your operating system This Software section shows the Properties window for Windows XP Your printer driver Properties window that appears in this User s Guide may differ depending on the printer in use NOTES e Most Windows applications will override settings you specify in the printer driver Change all print settings available in the software application first and change any remaining settings using the printer driver e The settings you change remain in effect only while you are using the current program To make your changes permanent make them in the Printers folder e The following procedure is for Wi
68. ged notify your dealer immediately Components may differ from one country to another e The Printer Driver CD contains the printer driver the SetIP the User s Guide and the Adobe Acrobat Reader program e The appearance of the power cord may differ depending on your country s specifications The power cord must be plugged into a grounded power socket CAUTION You must place your printer on a level surface If you do not print quality problems can occur 2 1 Setting Up Your Printer CAUTION If you have to move the printer laid a side or upside down remove the waste toner container from the printer and move it separately Or the inside of the printer may be contaminated i 4 Remove the toner cartridges from their bags 5 Holding the toner cartridges shake thoroughly them from Installing the Toner Ca rtridges side to side to distribute the toner 1 Open the front cover NOTE If toner gets on your clothing wipe it off with a dry cloth and wash it in cold water Hot water sets toner into fabric 7 Onthe imaging unit of the printer labels identify which colour cartridge goes into each cartridge slot Magenta 3 Remove four dummy caps which are on the toner cartridge entrances of the imaging unit 2 2 Setting Up Your Printer A 8 Grasp the toner cartridges and align them with the slots inside the printer Insert them into their corresponding slo
69. gth of less than 140 mm 5 5 in For optimum paper Ensure that any coloured paper or preprinted forms performance ensure that you are storing and handling the use inks that are compatible with this fusing temperature paper correctly Please refer to Printer and Paper Storage 180 C or 356 F for 0 1 second Environment on page 8 3 l l 8 2 Specifications Paper Specifications Category Specifications Acid Content 5 5 8 0 pH Caliper 0 094 0 18 mm 3 0 7 0 mils Curl in Ream Flat within 5 mm 0 02 in Cut Edge Conditions Cut with sharp blades with no visible fray Must not scorch melt offset or release hazardous emissions when heated to 180 C 356 F for 0 1 second Fusing Compatibility Grain Long Grain Moisture Content 4 6 by weight Smoothness 100 250 Sheffield Paper Output Capacity Output Tray Capacity Face down 100 sheets of 75 g m2 paper Paper Input Capacity Input Tray Capacity Tray 150 sheets of 75 g m paper Manual feed mode 1 sheet of 60 163 g m2 paper Specifications 8 3 Printer and Paper Storage Environment Paper storage environmental conditions directly affect the feed operation Ideally the printer and paper storage environment should be at or near room temperature and not too dry or humid Remember that paper is hygroscopic it absorbs and loses moisture rapidly Heat
70. han once and never print on a partial sheet of labels When selecting labels consider the quality of each component e Adhesives The adhesive material should be stable at 180 C 356 F the printer s fusing temperature e Arrangement Only use labels with no exposed backing between them Labels can peel off sheets with spaces between the labels causing serious jams e Curl Prior to printing labels must lie flat with no more than 0 5 in 13 mm of curl in any direction e Condition Do not use labels with wrinkles bubbles or other indications of separation See Printing on Labels on page 3 3 Transparencies Transparencies used in the machine must be able to withstand 180 C 356 F the machine s fusing temperature CAUTION To avoid damaging the machine use only transparencies recommended for use in laser printers INDEX C card stock print 3 5 cleaning inside 5 7 outside 5 7 components 1 2 configuration page print 5 1 connecting network 2 6 USB 2 6 custom sized materials print 3 5 D demo page print 2 7 envelopes print 3 3 ethernet cable connect 2 6 F features 1 1 I imaging unit life 8 1 replace 5 4 L labels print 3 3 LEDs status 1 3 Linux common problems 6 9 driver install 2 7 Macintosh common problems 6 8 driver install 2 7 manual feed use 3 2 network printing cable connect 2 6 network connected printer set 7 1 P paper choose 3 1 guide
71. he European Union and other European countries with separate collection systems This marking shown on the product or its literature indicates that it should not be disposed with other household wastes at the end of its working life To prevent possible harm to the environment or human health from uncontrolled waste disposal please separate this from other types of wastes and recycle it responsibly to promote the sustainable reuse of material resources Household users should contact either the retailer where they purchased this product or their local government office for details of where and how they can take this item for environmentally safe recycling Business users should contact their supplier and check the terms and conditions of the purchase contract This product should not be mixed with other commercial wastes for disposal Radio Frequency Emissions FCC Regulations This device complies with Part 15 of the FCC Rules Operation is subject to the following two conditions e This device may not cause harmful interference and e This device must accept any interference received including interference that may cause undesired operation This device has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can ra
72. he cable and garbled or printer to another computer and try incomplete a print job that you know works Finally try a new printer cable The wrong printer Check the application s printer driver was selected selection menu to ensure that your printer is selected The software Try printing a job from another application is application malfunctioning The operating system Exit Windows and reboot the is malfunctioning computer Turn the printer off and then back on again Pages print The toner cartridge is Redistribute the toner See page 5 2 but are defective or out of If necessary replace the toner blank toner cartridge The file may have Check the file to ensure that it does blank pages not contain blank pages Some parts in the Contact a service representative printer may be defective When you The setting in the Select Download as Bit Image in are using software application the Advanced Options window of Windows 98 is wrong the graphic properties window Print the the document again illustrations print incorrectly from Adobe Illustrator 6 3 Problem The print quality of photos is not good Images are not clear Possible Cause The resolution is set to Normal or Draft Solution Change the resolution to Best and then try printing again The resolution of the photo is very low If you increase the photo size in the software application the resolution will be reduced
73. he inside of the printer if you still have the same AaBbCc problems install a new toner cartridge of the AaBbCc problem colour See Replacing Toner Cartridges on page 5 3 AaBbCc e AaBbCc e Parts of the printer may have toner on them If the defects occur on the back of the page the problem will likely correct itself after a few more pages e The fusing assembly may be damaged Contact a service representative 6 6 Background scatter Problem Solution Background scatter results from bits of toner distributed on the printed page e The paper may be too damp Try printing with a different batch of paper Do not open packages of paper until necessary so that the paper does not absorb too much moisture If background scatter occurs on an envelope change the printing layout to avoid printing over areas that have overlapping seams on the reverse side Printing on seams can cause problems If background scatter covers the entire surface area of a printed page adjust the print resolution through your software application or via the printer properties window Misformed e If characters are improperly formed and producing characters hollowed images the paper stock may be too slick 2 Try a different paper See Paper Specifications on AaBbCc page 8 1 AaBbCc e If characters are improperly formed and producing AaBbCc a wavy effect the printer may need service Verify Aa
74. he machine through case or cabinet openings They may touch dangerous voltage points creating a risk of fire or shock Never spill liquid of any kind onto or into the machine 12 To reduce the risk of electric shock do not disassemble the machine Take it to a qualified service technician when repair work is required Opening or removing covers may expose you to dangerous voltages or other risks Incorrect reassembly could cause electric shock when the unit is subsequently used 13 Unplug the machine from the PC and AC wall outlet and refer servicing to qualified service personnel under the following conditions e When any part of the power cord plug or connecting cable is damaged or frayed e If liquid has been spilled into the machine e If the machine has been exposed to rain or water e If the machine does not operate properly after instructions have been followed e If the machine has been dropped or the cabinet appears damaged e If the machine exhibits a sudden and distinct change in performance 14 Adjust only those controls covered by the operating instructions Improper adjustment of other controls may result in damage and may require extensive work by a qualified service technician to restore the machine to normal operation 15 Avoid using this machine during a lightning storm There may be a remote risk of electric shock from lightning If possible unplug the AC power for the duration of the lightning storm 16 I
75. he printer Over time this build up can cause print quality problems such as toner specks or smearing Your printer has a cleaning mode that can correct and prevent these types of problems Cleaning the Outside of the Printer Clean the printer cabinet with a soft lint free cloth You can dampen the cloth slightly with water but be careful not to let any water drip onto the printer or inside of it CAUTION Cleaning the printer cabinet with cleaners containing large amounts of alcohol solvents or other strong substances can discolour or crack the cabinet CAUTION e Do not touch the green surface on the imaging unit with your hands or any other material Use the handle on it in order to avoid touching this area e Be careful not to scratch the surface of the imaging unit e To prevent damage do not expose the imaging unit to light for more than a few minutes Cover it with a piece of paper to protect it if necessary Cleaning the Inside of the Printer 1 Turn the printer off and unplug the power cord then wait a few minutes for the printer to cool 2 Open the front cover 5 Look inside the printer Remove any dust paper particles and spilled toner with a damp soft lint free cloth 3 Pullthe imaging unit out of the printer using the handle on its bottom NOTE After cleaning let the printer to dry completely 6 Pull the imaging unit about half and push it until it sounds click Repea
76. ilter files on your computer Open Print Setup Utility from the Utilities folder Click Add on the Printer List Select the USB tab Select Xerox in Printer Model and your printer in Model Name Click Add Your printer appears on the Printer List and is set as the default printer aA ARAWN 23 Using Your Printer with a Macintosh Changing Printer Settings Printing You can use advanced printing features when using your printer From your Macintosh application select Print from the File NOTES menu The printer name which appears in the printer properties The Macintosh printer s properties window that appears in window may differ depending on the printer in use Except for this User s Guide may differ depending on the printer in use the name the composition of the printer properties window is However the composition of the printer properties window is similar similar e You can check your printer name in the supplied Layout Setting Printer software CD The Layout tab provides options to adjust how the document appears on the printed page You can print multiple pages on one sheet of paper Select Layout from the Presets drop down list to access the Printing a Document following features For details see Printing Multiple Pages on One Sheet of Paper on the next column When you print with a Macintosh you need to check the printer software setting in each application you use Follow these steps
77. in the left pane The right pane shows a number of tabs that display information regarding the currently selected printer Select your printer driver if not currently selected K Linux Printer Confiquration File Print Printer Help Add Printer Remove Resume Printer Status Info PADANIE E Linux Printers NOTE You must log in as a super user root to uninstall the printer software If you are not a super user ask your system administrator Other Printers Type Local Description Location State Idle Language Device Model Go to the Web page for this printer M 4 A message window asking for confirmation to proceed with the uninstallation appears Click Yes 5 Select Complete uninstall and then click Uninstall K Uninstall Tool Please select the packages you would like to uninstall Linux Printer Package Complete uninstall 3 The Info tab shows general information about the printer If you are an Internet user you can click Go to the Web page for this printer to access the Xerox web page Click the Job tab to inspect and manage the job queue for the selected printer You can suspend resume or delete a specific job s in the queue If you drag a specific job s Recovered space 3 MB you can drop it into the print queue of another printer Exit 6 Click OK to begin uni
78. ing a Document on page 5 2 Click the Extras tab and click the Edit button in the Watermark section The Edit Watermark window appears 3 Select the watermark you want to edit from the Current Watermarks list and change the watermark message and options 4 Click Update to save the changes 5 Click OK until you exit the Print window Deleting a Watermark 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 2 From the Extras tab click the Edit button in the Watermark section The Edit Watermark window appears 3 Select the watermark you want to delete from the Current Watermarks list and click Delete 4 Click OK until you exit the Print window H Regards WORLD BEST WORLD BEST Using Overlays What is an Overlay An overlay is text and or images stored in the computer hard disk drive HDD as a special file format that can be printed on any document Overlays are often used to take the place of preprinted forms and letterhead paper Rather than using preprinted letterhead you can create an overlay containing the exact same information that is currently on your letterhead To print a letter with your company s letterhead you do not need to load preprinted letterhead paper in the printer You need only tell the printer to print the letterhead overlay on your document NO
79. int from a Linux based computer with your printer Go to the Software Section for information about installing the Linux driver and printing from a Linux environment System Requirements Before you begin ensure that your system meets the minimum requirements Your printer supports the following operating system e Windows 98 Me NT 4 0 2000 XP 2003 The following table shows Windows requirements Item Requirements Operating System Windows 98 Me NT 4 0 2000 XP 2003 RAM 98 Me 32 MB NT 4 0 2000 64 MB XP 128 MB 2003 256 MB Free Disk Space 98 Me NT 4 0 300 MB 2000 XP 2003 Internet Explorer 5 0 or higher NOTES e For Windows NT 4 0 2000 XP 2003 the system administrator should install the software e Windows NT 4 0 is only supported on the Phaser 6110N e Macintosh 10 3 10 4 For details see the Software Section e Various Linux OS For details see the Software Section Setting Up Your Printer 2 8 Printer Driver Features Your printer drivers will support the following standard options e Paper source selection e Paper size orientation and media type e number of copies The table below lists a general overview of features supported by your printer drivers Printer driver Win98 Me NT Macintosh 4 0 2000 XP CUPS Feature 2003 Colour Mode Y Y Y Black amp White Y Y Y Print Quality Option Y Y Y Poster Printing Y N N Manual Doub
80. inter when it is turned on or plugged in Doing so may give you an electric shock NOTE Each LED blinks red in a repeated order Wait for about 1 5 minutes for the printer to get ready Printing a Demo Page Print a demo page to make sure that the printer is operating correctly To print a demo page In Ready mode press and hold the button for 2 seconds A demo page showing the printer s features and capabilities is printed Setting Up Your Printer 2 7 Installing the Printer Software You must install software using the supplied printer driver CD after you have set up your printer and connected it to your computer For details see the Software Section The printer driver CD provides you with the following software Programs for Windows You can install the following printer software using the printer driver CD e Printer driver for Windows Use this driver to take full advantage of your printer s features See the Software Section for details about installing the Xerox printer driver e Status Monitor Appears when printing errors occur See the Software Section for details about installing the Status Monitor program Printer Settings Utility you can configure print settings Macintosh Printer Driver You can print from a Macintosh with your printer Go to the Software Section for information about installing the print software and printing from a Macintosh Linux Driver You can pr
81. k Quit 22 Using Your Printer with a Macintosh Setting Up the Printer Set up for your printer will be different depending on which cable you use to connect the printer to your computer the network cable or the USB cable For a Network connected Macintosh NOTE Some printers do not support a network interface Before connecting your printer make sure that your printer supports a network interface by referring to Printer Specifications in your Printer User s Guide i 1 Follow the instructions on Installing Software for Macintosh on page 22 to install the PPD and Filter files on your computer Open Print Setup Utility from the Utilities folder Click Add on the Printer List Select the IP Printing tab U AUN Select Socket HP Jet Direct in Printer Type WHEN PRINTING A DOCUMENT CONTAINING MANY PAGES PRINTING PERFORMANCE MAY BE ENHANCED BY CHOOSING SOCKET FOR PRINTER TYPE OPTION I 6 Enter the printer s IP address in the Printer Address field 7 Enter the queue name in the Queue Name field If you cannot determine the queue name for your printer server try using the default queue first 8 Select Xerox in Printer Model and your printer in Model Name 9 Click Add 10 Your printer s IP address appears on the Printer List and is set as the default printer For a USB connected Macintosh 1 Follow the instructions on Installing Software for Macintosh on page 22 to install the PPD and F
82. le Y N N sided Printing Multiple Pages Per Y Y Y Sheet N up Fit to Page Printing Y N N Scale Printing Y N Y Booklet Printing Y N N Watermark Y N N Overlay Y N N The Overlay feature is not supported in NT4 0 NOTE For details about installing software and using its features see the Software Section Using Print Materials This chapter describes the types of paper you can use with your printer and how to properly load paper in the tray for the best print quality This chapter includes e Choosing Paper and Other Materials e Verifying the Output Location e Loading Paper e Printing on Special Print Materials Choosing Paper and Other Materials You can print on a variety of print materials such as plain paper envelopes labels card stock and so on See Printing on Special Print Materials on page 3 3 To get the best possible print quality use only high quality copier grade paper When you choose print materials consider the following Desired outcome The paper you choose should be appropriate for the project Size You can use any size paper that fits easily within the paper adjusters of the tray Weight Your printer supports paper weights as follows i 16 24 Ibs bond 60 90 g m for the tray 16 43 lbs bond 60 163 g m for the manual feed mode Brightness Some papers are whiter than others and produce sharper more vibrant images
83. line 3 1 loading 3 2 sizes and capacities 3 1 specifications 8 1 paper jams clear 6 3 paper load capacity 3 1 paper size change in the tray 2 5 paper load 2 3 preprinted paper print 3 4 print quality problems solve 6 5 printer driver install 2 7 printing configuration page 5 1 demo page 2 7 problem solve checklist 6 1 general 6 2 Linux 6 9 Macintosh 6 8 paper jams 6 3 print quality 6 5 Windows 6 8 Q quality problems solve 6 5 R replacing imaging unit 5 4 toner cartridge 5 3 waste toner container 5 6 S specification paper 8 3 printer 8 1 T toner cartridge maintaining 5 2 redistributing 5 2 replacing 5 3 transparency print 3 4 U USB connect 2 6 W waste toner container life 8 1 replace 5 6 Phaser 6110 Series XEROX Colour laser printer Software section Section Logiciel Softwaredokumentation Sezione software Secci n de software Manual do Usu rio do Software Software IporpaMMHoe obecneyeHue Sekcja Oprogramowanie Szoftverszakasz Sekce softwaru Yazilim b l m Softwareafsnit Ohjelmisto Om programvaren EVOTNTA AOyIOUIKOU Om programvara www xerox com office support Software section Contents Chapter 1 INSTALLING PRINTER SOFTWARE IN WINDOWS Installing SoftWare veria a sas alada ada 3 Removing SOFTWA istiicirada ii A A A 3 Chapter 2 USING SETIP Chapter 3 BASIC PRINTING Printing a Document eiii e cd ct a 5 Printer Settings ia EUN 6
84. loth and wash it in cold water Hot water sets toner into fabric 7 Grasp the toner cartridge and align it with the corresponding slot inside the printer Insert it into its slot until it clicks into place LCR lt gt lt Z 8 Close the front cover Make sure that the cover is securely latched and then turn the printer on CAUTION If the front cover is not completely closed the printer will not operate NOTES e Each LED blinks red in a repeated order Wait for about 1 5 minutes for the printer to get ready e When printing text at 5 coverage you can expect a toner cartridge life of about 2 000 pages for black and white printing and 1 000 pages for colour printing However the toner cartridge that is shipped with the printer prints 1 500 pages for black and white 700 pages for colours 5 4 Replacing the Imaging Unit The life of the imaging unit is approximately 20 000 pages for black or 50 000 images When the life span of the imaging unit has expired the Status Monitor program window appears on the computer indicating the imaging unit needs to be replaced Otherwise your printer stops printing To replace the imaging unit 1 Turn the printer off then wait a few minutes for the printer to cool 2 Open the front cover 3 Remove all of the toner cartridges and waste toner container from the printer 4 Pullthe imaging unit out of the printer using the handle on its bottom
85. ly run click the fill icon at the bottom of the window When the 6 The printer driver installation begins When the installation Terminal screen appears type in is completed click Start root local root mount t iso9660 dev hdc mnt cdrom Assuming that dev hdc is your CD ROM path and you KE Line Printer Package Setup EE have mnt cdrom directory Install Complete root local root cd mnt cdrom the CD ROM directory es er dc root local cdrom setup sh The product was installed in usr local linuxprinter Type linux config to start the program 4 Select the type of installation either Recommended or Expert and then click Continue K Linux Printer Package Setup six Please choose the class of installation pu E Recommended View Readme Start 7 The Linux Printer Configuration window opens Click the Add Printer icon on the toolbar at the top of the window Q Expert int NOTE Depending on the printing system in use the ackage Se Administrator Login window may appear Type in root in the 2 v J E Login field and enter the system password 8 You see the printers currently installed in your system Recommended is fully automated and does not require Select the printer you want to use The function tabs any interaction Expert installation allows you to select av
86. m When the Custom Page Size window appears set the paper size and click OK The setting appears in the list so that you can select it Basic Printing 7 Source Make sure that Source is set to the corresponding paper tray Use Manual Feed when printing on special materials like envelopes and transparencies You have to load one sheet at a time into the Manual Tray Type Set Type to correspond to the paper loaded in the tray from which you want to print This will let you get the best quality printout If not print quality may not be acheived as you want Cotton 20 Ib to 24 Ib 75 90 g m2 cotton paper such as Gilbert 25 and Gilbert 100 96 Plain Paper Normal plain paper Select this type if your printer is monochrome and printing on the 16 Ib 60 g m2 cotton paper Recycled 20 Ib to 24 Ib 75 90 g m2 recycled paper Colour Paper 20 Ib to 24 Ib 75 90 g m2 colour backgrounded paper Scaling Scaling allows you to automatically or manually scale your print job on a page You can choose from None Reduce Enlarge and Fit to Page e For details see Printing a Reduced or Enlarged Document on page 12 e For details see Fitting Your Document to a Selected Paper Size on page 12 Graphics Tab Use the following Graphic options to adjust the print quality for your specific printing needs See Printing a Document on page 5 for more information on accessing printer properties Click the Graphics tab to
87. m of paper is to rewrap it tightly in its moisture proof wrapping If the printer environment is subject to extremes unwrap only the amount of paper to be used during the day s operation to prevent unwanted moisture changes Envelopes Envelope construction is critical Envelope fold lines can vary considerably not only between manufacturers but also within a box from the same manufacturer Successful printing on envelopes depends upon the quality of the envelopes When selecting envelopes consider the following factors e Weight The weight of the envelope paper should not exceed 90 g m 24 Ib or jamming may occur e Construction Prior to printing envelopes should lie flat with less than 6 mm 0 25 in curl and should not contain air e Condition Envelopes should not be wrinkled nicked or otherwise damaged e Temperature You should use envelopes that are compatible with the heat and pressure of the printer e Size You should only use envelopes within the following size ranges 8 5 x 14 in 216 x 356 mm Tray 3x5in 76 x 127 mm NOTE You may experience some paper jams when using any media with a length less than 127 mm 5 in This may be caused by paper that has been affected by environmental conditions For optimum performance make sure you are storing and handling the paper correctly Please refer to Printer and Paper Storage Environment on page 8 3 I Envelopes with Double Side Sea
88. ms Double side seam construction has vertical seams at both ends of the envelope rather than diagonal seams This style may be more likely to wrinkle Be sure the seam extends all the way to the corner of the envelope as illustrated below Correct Incorrect Envelopes with Adhesive Strips or Flaps Envelopes with a peel off adhesive strip or with more than one flap that folds over to seal must use adhesives compatible with the heat and pressure in the printer The extra flaps and strips might cause wrinkling creasing or even jams and may even damage the fuser i 8 4 Specifications Envelope Margins The following gives typical address margins for a commercial 10 or DL envelope Type of Address Minimum Maximum Return address 0 6 in 15 mm 2 in 51 mm Delivery address 2 in 51 mm 3 5 in 90 mm NoTES e For best print quality position margins no closer than 0 6 in 15 mm from the edges of the envelope e Avoid printing over the area where the envelope s seams meet Envelope Storage Proper storage of envelopes helps contribute to print quality Envelopes should be stored flat If airis trapped in an envelope creating an air bubble then the envelope may wrinkle during printing See Printing on Envelopes on page 3 3 Labels CAUTION e To avoid damaging the printer use only labels recommended for laser printers e Never print on the same sheet of labels more t
89. ndows XP For other Windows OS refer to the corresponding Windows User s Guide or online help 1 Click the Windows Start button 2 Select Printers and Faxes 3 Select your printer driver icon 4 Right click on the printer driver icon and select Printing Preferences 5 Change the settings on each tab click OK Basic Printing Layout Tab The Layout tab provides options to adjust how the document appears on the printed page The Layout Options includes Multiple Pages per Side and Poster See Printing a Document on page 5 for more information on accessing printer properties E Xerox Phaser 6110 Printing Preferences Je Layout Paper Graphics Other Features Troubleshooting 1 Orientation m 9 X Lal Rotate 180 Degrees 2 Layout Options Type Multiple Pages per Side y Pages per Side 1 Aa Ad p Print Page B 210 x 297 mm 3 Double sided Printing Manual mm C inch None Copies 1 P C Long Edge Quality Normal Short Edge Favorites 7 Printer Default x hen Orientation Orientation allows you to select the direction in which information is printed on a page Portrait prints across the width of the page letter style Landscape prints across the length of the page spreadsheet style 7 mo o s gt ow e un o E yo D e Rotate 180 Degrees allows you to rotate the page 180 d
90. ner cartridge depends on the amount of toner that your print jobs require When printing text at 5 coverage the toner cartridges last an average of 2 000 pages for black and white printing and 1 000 pages for each colour printing However the toner cartridge that is shipped with the printer prints 1 500 pages for black and white 700 pages for colours Redistributing Toner When a toner cartridge is low on toner faded or light areas may appear It is also possible that coloured images may be printed with incorrect colours due to flawed mixing of toner colours when one of the coloured toner cartridges is low on toner The Status Monitor program window appears on the computer telling you which colour cartridge is low on toner Also when the toner LED on the control panel indicating each individual toner cartridge according to its colour blinks the toner cartridge is low The printer is able to continue to print using the current toner cartridge until the Status Monitor program window appears on the computer telling you to replace the cartridge You may be able to temporarily improve print quality by redistributing the toner To redistribute the toner 1 Open the front cover 2 Pull the corresponding toner cartridge out to remove from the printer 3 Holding the toner cartridge shake thoroughly it from side to side to redistribute the toner Supplies and maintenance items 4 Grasp the toner cartridge and align i
91. nstallation 7 When the uninstallation is completed click Finished 20 Using Your Printer in Linux The Properties tab allows you to change the default printer settings K Linux Printer Configuration File Print Printer Help IN lalola Info into uobs Properties Extra Resolution 500 DPI E omiiia Printers A p Other Printers General Page Size US Letter Paper Source Auto Select Paper Type Use Printer Default Power Save Time Smin 4 gt a ae ae Reprint On Factory Defaults NOTE Regular users are able to override the system wide default settings defined by the administrator When a regular user clicks Apply these custom settings will be saved in the user s profile and may be used later with LLPR If the administrator is running the configuration tool then the settings will be saved as the new global defaults Changing LLPR Properties You can fine tune the printer s properties by opening the LLPR Properties window To open the LLPR Properties window 1 From the application you are using select the Print command 2 When the Linux LPR window opens click Properties K Linux LPR CINES Printer Name ip gt Properties State Idle Fee fat pas Click Properties Location Comment Page Selection Copies All Pag
92. on I can t change settings in the configuration tool You need to have administrator privileges to be able to change global settings I am using the KDE desktop but the configuration tool and LLPR won t start You may not have the GTK libraries installed These usually come with most Linux distributions but you may have to install them manually Refer to your distribution s installation manual for more details about installing additional packages I can t make a printer the system default Problem Possible Cause and Solution I In some conditions it may not be possible to change the default queue This happens with some variants of LPRng especially on recent RedHat systems that use the printconf database of queues When using printconf the etc printcap file is automatically refreshed from the database of printers managed by the system usually through the printtool command and the queues in etc printcap local are appended to the resulting file The default queue in LPRng is defined as the first queue in etc printcap and therefore it is not possible for the Linux Printer Package to change the default when some queues have otherwise been defined using printtool LPD systems identify the default queue as the one named Ip Thus if there is already a queue by this name and if it doesn t have an alias then you won t be able to change the default To work around this you can either delete the que
93. ong periods of time Dust and dirt may accumulate on them resulting in spotty printing To avoid smudging caused by fingerprints handle them and coated paper carefully To avoid fading do not expose the printed transparencies to prolonged sunlight CAUTION It is not recommended to use paperbacked transparencies such as Xerox 3R91334 which can cause a jam or be scratched To print on transparency 1 Squeeze the paper length guide and slide it out to its full length 2 Load a sheet of transparency in the tray with the print side up and the top short edge in first Adjust the guides to fit the length and width of the transparency 3 When you print set the paper source to Manual Feed and the paper type to Transparency and select the appropriate size in the software application For details see the Software Section 4 Press the 6 button on the printer to start feeding Using Print Materials Printing on Preprinted Paper Preprinted paper is paper that has some type of printing on it before it is sent through the printer paper that has a preprinted logo at the top of the page for example Letterhead must be printed with heat resistant ink that will not melt vaporize or release hazardous emissions when subjected to the printer s fusing temperature of 180 C 356 9F for 0 1 seconds Ink on letterhead must be non flammable and should not adversely affect printer rollers Forms and lett
94. ositioned correctly Do not overload the tray e Do not remove the paper from the tray while printing e Flex fan and straighten the paper before loading e Do not use creased damp or highly curled paper e Do not mix paper types in a tray Use only recommended print materials See Paper Specifications on page 8 1 e Ensure that the recommended print side of print materials is facing up in the tray The paper may not meet specifications for example the paper is too moist or too rough See Paper Specifications on page 8 1 Dropouts If generally rounded faded areas occur randomly on the page AaBbCc A single sheet of paper may be defective Try AaBbOc reprinting the job The moisture content of the paper is uneven or the AaBbCc paper has moist spots on its surface Try a different AaBbCc brand of paper See Paper Specifications on AaBbCc page 8 1 L The paper lot is bad The manufacturing process can cause some areas to reject toner Try a different kind or brand of paper The toner cartridge may be defective See Vertical repetitive defects on the next page Change the printer option and try again Go to printer properties click Paper tab and set paper type to Thick Refer to the Software Section for details If these steps do not correct the problems contact a service representative 6 5 Solving Problems Problem Solution
95. ow the current settings These margins do not apply when printing regular PostScript data eImage allows you to set image options that will be used when printing image files i e when a non PostScript document is passed to LLPR on the command line Colour settings will also take effect for postscript documents eText allows you to select the text density and turn the syntax colouring on or off HP GL 2 allows you to set default options to print HP GL 2 format documents used by some plotters Advanced allows you to override the default settings for the printer If you click the Save button at the bottom of the window the options will be retained between LLPR sessions Use the Help button to view details about the options in the window To apply the options click OK in the LLPR Properties window You will return to the Linux LPR window To start printing click OK Install the Printer driver 8 Usi ng You r P FI nte r with 1 Make sure that you connect your printer to the computer a M a ci ntosh Turn on your computer and printer Insert the Printer software CD which came with your printer into the CD ROM drive Double click CD ROM icon that appears on your Macintosh desktop Double click the MAC Installer folder Double click the MAC Printer folder Double click the Phaser 6110 Installer icon Enter the password and click OK Your printer supports Macintosh systems with a built in USB interface or 10 100 Bas
96. parts of graphics text or illustrations are missing Incompatibility between the PDF file and the Acrobat products Printing the PDF file as an image may solve this problem Turn on Print As Image from the Acrobat printing options NoTE It will take longer to print when you print a PDF file as an image NOTE Refer to the Microsoft Windows 98 Me NT 4 0 2000 2003 XP User s Guide that came with your PC for further information on Windows error messages Common Macintosh Problems Problem Possible Cause and Solution The printer does not print PDF file correctly Some parts of graphics text or illustrations are missing Incompatibility between the PDF file and the Acrobat products Printing the PDF file as an image may solve this problem Turn on Print As Image from the Acrobat printing options NOTE It will take longer to print when you print a PDF file as an image The document has printed but the print job has not disappeared from the spooler in Mac OS 10 3 2 Update your Mac OS to OS 10 3 3 or higher Solving Problems Problem Some letters are not displayed normally during the Cover page printing Possible Cause and Solution This problem is caused because Mac OS can not create the font during the Cover page printing English alphabet and numbers are displayed normally at the Cover page Common Linux Problems Problem Possible Cause and Soluti
97. r 6110 Series icon 4 From the Document menu select Cancel Printing Windows 98 Me or Cancel Windows NT 4 0 2000 XP 2003 NOTE You can also access this window by simply double clicking the printer icon at the bottom right corner of the Windows desktop You can also cancel the current job by pressing the button on the control panel of your printer Supplies and maintenance items This chapter provides information for maintaining your printer and the toner cartridges This chapter includes e Printing a Configuration Page e Replacing supplies and maintenance items e Managing Toner Cartridges e Replacing Toner Cartridges e Replacing the Imaging Unit e Replacing the Waste Toner Container e Cleaning the Printer Printing a Configuration Page You can print a configuration page from the printer s control panel Use the configuration page to view the current settings to help troubleshoot problems To print a configuration page In Ready mode press and hold the button on the control panel for 5 seconds A configuration page prints out Replacing supplies and maintenance items From time to time you need to replace the following items to maintain top performance and to avoid print quality problems resulting from worn parts The following items should be replaced after you have printed the specified number of pages or when the life span of each item has expired The St
98. r prints A4 sized paper at 16 ppm in black and white mode and 4 ppm in colour mode Use multiple types of media easily 150 gt The Standard 150 sheet tray supports A4 letter sized Z paper and special materials like letterhead envelopes labels custom sized materials postcards transparency and heavy paper Create professional documents e Print Watermarks You can customize your documents with a watermark such as the word Confidential For details see the Software Section e Print Posters The text and pictures of each page of your document can be magnified and printed across several sheets of paper and taped together to form a poster For details see the Software Section e Print Booklets This feature enables you to easily print a document to create a book Once printed all you have to do is fold and staple the pages For details see the Software Section Introduction 1 1 Save time and money e You can print multiple pages on a single sheet of paper to save paper e You can manually print on both sides of the paper Manual double sided printing in Windows and Macintosh For details see the Software Section You can use preprinted forms and letterhead For details see the Software Section e This printer automatically conserves electricity by substantially reducing power consumption when not printing Print in various environments You can print in Windows
99. remove any 4 Installing Software item individually When your computer asks you to confirm your selection click Yes or OK All applications should be closed on your PC before beginning The selected driver and all of its components are removed installation from your computer 5 After the software is removed click OK or Finish NOTE If the New Hardware Wizard window appears during the installation procedure click xj in the upper right corner of the box to close the window or click Cancel 1 Insert the supplied CD ROM into your CD ROM drive The CD ROM should automatically run and an installation window appears E Varus Presas BJ JU E XEROX Y 2 IY A Install Software View User s Guide Install Acrobat Reader Optional Install SetIP Utility Optional Change Language Exit Program 2 Choose the type of installation 3 Follow the instructions on the screen to complete the installation NOTE If the installation window does not appear click Start and then Run Type X Setup exe replacing X with the letter which represents your drive and click OK 3 Installing Printer Software in Windows 2 Using SetIP NOTE To install Set IP select Install SetIP Utility on installation window appears For details see Installing Software on page 3 1 From the Windows Start menu select Programs or All Programs gt Xerox Phaser 6110 gt SetIP gt SetIP The program
100. ridge is blinks red totally exhausted ina e The each toner cartridge is repeated wrong order NOTE All printing errors will be appear in the Status Monitor program window Stop o g button Function Description Printing In Ready mode press and hold this button demo page for about 2 seconds until the H LED blinks fast and release Description Printing In Ready mode press and hold this button configuration for about 5 seconds until the H LED lights green All LEDs The printer is ready to print sheets blinks fast and release off Canceling Press this button during printing The red slowly blinks All LEDs The printer is receiving data from print job LED blinks while the print job is cleared green off the computer from both the printer and the computer and then the printer returns to Ready fast blinks All LEDs The printer is printing data mode This may take some time depending green off on the size of the print job lights red All LEDs The printer is experiencing an off error such as jammed paper open cover empty paper not installated waste toner container or full waste toner container e The printer is experiencing a service required error such as LSU error fuser error or ITB error Contact your sales or service representative lights green each LED The each colour toner cartridge is blinks red near the end of its life blinks red each LED The ea
101. rk If you work in a networked environment the printer can be shared by other users on the network This chapter includes e About Sharing the Printer on a Network e Setting Up a Network Connected Printer Phaser 6110N only NOTE If you are a Phaser 6110N user you can only connect your printer to a network locally for use via a single computer About Sharing the Printer on a Network If you work in a networked environment you can connect your printer to the network Locally Shared Printer You can connect the printer directly to a selected computer which is called the host computer on the network The printer can then be shared by other users on the network through a Windows 98 Me XP NT 4 0 2000 2003 network printer connection For details about sharing the printer locally see the Software Section Wired Network connected Printer Phaser 6110N only The Phaser 6110N printer has a built in network interface For more information about connecting your printer to a network see 2 6 Printing Across a Network Whether the printer is locally connected or network connected you need to install the Phaser 6110N series printer software on each computer that prints documents using the printer 7 1 Setting Up a Network Connected Printer Phaser 6110N only You have to set up the network protocols on the printer to use it as your network printer Setting protocols can be accomplished by using th
102. s content to appear larger or smaller on the printed page 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 From the Paper tab select Reduce Enlarge in the Type drop down list Enter the scaling rate in the Percentage input box Q N You can also click the w or A button Select the paper source size and type in Paper Options Click OK and print the document g Fitting Your Document to a Selected Paper Size This printer feature allows you to scale your print job to any selected paper size regardless of the digital document size This can be useful when you want to check fine details on a small document 1 To change the print settings from your software application access printer properties See Printing a Document on page 5 From the Paper tab select Fit to Page in the Type drop down list Select the correct size from the Target Page drop down list Select the paper source size and type in Paper Options Click OK and print the document uh Y N Using Watermarks The Watermark option allows you to print text over an existing document For example you may want to have large gray letters reading DRAFT or CONFIDENTIAL printed diagonally across the first page or all pages of a document There are several predefined watermarks that come with the printer and they can be modified or you can add new ones to th
103. s u uuu u a iovis a velar ses de annee orien FUR nn eee or are De d a o dE a 3 4 Printing on Preprinted Paper iie aerei cd o I E ENGRA 3 4 Printing on Card Stock or Custom sized Materials ss 3 5 4 Basic Printing Printingia Document 5 22 p aaa ce e OR SER cee seine mises nie ERR TE ra ue AD KMe E FED Tia UM 4 1 Canceling Print oo eL 4 1 5 Supplies and maintenance items Printing a Configuration PAGE uuu ina nnn ora px tenant nad Xx oa Ree tau io ERU anne DI NE tte NO n npe aga 5 1 Replacing supplies and maintenance items sssssssssesenmeneemneemenmeee meme nennen renes 5 1 Managing Toner Cartridges esses aaepe nd pa aea RR ERR XR ia ARR PRA Y PRG FS aasawa was ua usaq asss 5 2 Toner Cartridge Storage i orte re eta reta tens i a anne se TU read E anne Era 5 2 Toner Cartridge Life ExpectanCcy 4 sees nnne nnn hh nnn nena kh h hn a EESTE A mine E EENE 5 2 Redistrib tirig TOMER ios ceci a id 5 2 Replacing Toner Cartridges miii a dea 5 3 Replacing the Imaging UMIE srnnciiionin a AKI RATER RI MEA KK AME AE 5 4 Replacing the Waste Toner Container uuu luas a nasa se 5 6 Cleaning the Printer ua iicet era rmn treinta crine ipu tac ka kk t ERR RENE lets tend OI EAA EEA ATERA ERAN ARE ees 5 7 Cleaning the Outside of the Printer oomcorccosccncccnoncaranenccananrnnar nana acar arrancar rr rr rc 5 7 Cleaning the Inside of the Printer c cccecsceeeeecereeeeceeeenseeeeceeseeeaseesseeneneeecteeaeeanege
104. see Software Section 3 Press the e amp button on the printer to start feeding NOTE If you do not press the button after a pause the paper will be automatically fed into the printer 4 Printing is started 5 If you are printing multiple pages load the next sheet after the first page prints out and press the button Repeat this step for every page to be printed A Printing on Special Print Materials Printing on Envelopes e Only use envelopes recommended for your printer Before loading envelopes in the tray make sure that they are undamaged and are not stuck together e Do not feed stamped envelopes e Never use envelopes with clasps snaps windows coated linings or self stick adhesives To print on envelope 1 Squeeze the paper length guide and slide it out to its full length 2 Load a sheet of envelope in the tray with the flap side down The end of the envelope with the stamp area enters the printer first 3 Slide in the paper length guide until it lightly touches the end of the paper stack 4 Slide the paper width guide to the edge of the envelope without causing it to bend CAUTION If you print 20 envelopes in succession the surface of the top cover may become hot Please exercise caution 5 When you print set the paper source to Manual Feed and the paper type to Envelope and select the appropriate size in the software application For details see the Software Se
105. t this action two or three times 5 7 Supplies and maintenance items 7 Push the imaging unit until it sounds click in to the printer CAUTION If the front cover is not completely closed the printer will not operate 9 Plug the power cord in and turn the printer on DM CAUTION If there is a e cracking sound re install the imaging unit The imaging unit is not properly installed 5 8 Supplies and maintenance items Solving Problems This chapter provides helpful information for what to do if you encounter an error while using your printer This chapter includes e Troubleshooting Checklist e Solving General Printing Problems e Clearing Paper Jams e Solving Print Quality Problems e Common Windows Problems e Common Macintosh Problems e Common Linux Problems 6 1 Troubleshooting Checklist If the printer is not working properly consult the following checklist If the printer does not pass a step follow the corresponding troubleshooting suggestions Make sure that the Ei LED on the control panel green and Ready is shown on the Status Monitor program window Status Response e If the LED is off check the power cord connection Check the power switch Check the power source by plugging the power cord into another outlet If the LED blinks or lights red solve the problems See Troubleshooting Error Messages on page 6 8 or contact your ser
106. t with the corresponding slot inside the printer Insert it back into its slot until it clicks into place NOTE If toner gets on your clothing wipe it off with a dry cloth and wash it in cold water Hot water sets toner into fabric 5 Close the front cover Make sure that the cover is securely closed Replacing Toner Cartridges The printer uses four colours and has a different toner cartridge for each one yellow Y magenta M cyan C and black K When the Toner LED on the control panel indicating each individual toner cartridge according to its colour lights and the LED lights red the toner cartridge is totally exhausted Your printer stops printing Also the Status Monitor program window appears on the computer telling you to replace the cartridge NOTE The print quality may get poor if the refilled toner cartridge is installed since its characteristics may significantly differ from the genuine To replace the toner cartridge 1 Turn the printer off then wait a few minutes for the printer to cool 5 3 Supplies and maintenance items 2 Open the front cover 3 Pull the corresponding toner cartridge out to remove from the printer 4 Take a new toner cartridge out of its package 5 Holding the toner cartridge shake thoroughly it from side to side to distribute the toner NOTE If toner gets on your clothing wipe it off with a dry c
107. tand the printer s fusing temperature of 180 C 356 F for 0 1 seconds without deteriorating Do not use paper with a coloured coating that was added after the paper was produced Preprinted forms must be printed with nonflammable heat resistant ink that does not melt vaporize or release hazardous emissions when subjected to the printer s fusing temperature Load special paper types one sheet at a time Store paper in its ream wrapper until you are ready to use it Place cartons on pallets or shelves not on the floor Do not place heavy objects on top of the paper whether it is packaged or unpackaged Keep paper away from moisture direct sunlight or other conditions that can cause it to wrinkle or curl NOTES e Do not use carbonless paper or tracing paper These types of paper are unstable at the fusing temperature and can give off fumes or cause damage to the printer e Sometimes damp paper produces steam during the fusing stage of printing This should not cause concern Verifying the Output Location The printer has the output tray that collects paper face down in correct order NOTES e If you continuously print many pages the surface of the output tray may become hot Be careful not to touch the surface and especially keep children away from the surface e The output tray can hold up to 100 sheets of paper Remove the pages so that the tray is not overloaded Loading Paper
108. ted a number of different options you may have exceeded the length of the options and some of your choices won t be passed to the programs responsible for implementing them Try to select fewer options that deviate from the defaults to save on memory usage I am trying to print a document in Landscape mode but it prints rotated and cropped Most Unix applications that offer a Landscape orientation option in their printing options will generate correct PostScript code that should be printed as is In that case you need to make sure that you leave the LLPR option set to its default Portrait setting to avoid unwanted rotations of the page that would result in cropped output Solving Problems Problem Possible Cause and Solution Some pages come out all white nothing is printed and I am using CUPS If the data being sent is in Encapsulated PostScript EPS format some earlier versions of CUPS 1 1 10 and before have a bug preventing them from being processed correctly When going through LLPR to print the Printer Package will work around this issue by converting the data to regular PostScript However if your application bypasses LLPR and feeds EPS data to CUPS the document may not print correctly I can t print to an SMB Windows printer To be able to configure and use SMB shared printers such as printers shared on a Windows printer you need to have a correct installation of the SAMBA p
109. though I don t choose them in LLPR There may be some local options defined in your Ipoptions file which are manipulated by the Ipoptions command These options are always used if not overridden by LLPR settings To get rid of all options for a printer run the following command replacing printer with the name of the queue Ipoptions x printer I configured a printer to print to a file but I get Permission denied errors Most printing systems will not run as the super user but as a special user usually Ip Therefore make sure that the file you have chosen to print to is accessible to the user owning the spooler daemon 6 10 Problem Possible Cause and Solution On my PCL or GDI printer I sometimes get error messages printing instead of my document Unfortunately some Unix applications may generate non compliant PostScript output that may not be supported by Ghostscript or even the printer itself in PostScript mode You can try to capture the output to a file and view the results with Ghostscript gv or ghostview will allow you to do so interactively and see if you get error messages However since the application is probably at fault contact your software vendor to inform them of the issue Some colour images come out all black This is a known bug in Ghostscript until GNU Ghostscript version 7 05 when the base colour space of the document is indexed colour space and it is conv
110. ts until they click into place 9 Close the front cover Make sure that the cover is securely closed CAUTION If the front cover is not completely closed the printer will not operate NOTE When printing text at 5 coverage you can expect a toner cartridge life of about 2 000 pages for black and white printing and 1 000 pages for colour printing However the toner cartridge that is shipped with the printer prints 1 500 pages for black and white 700 pages for colours 2 3 Setting Up Your Printer Loading Paper The tray can hold a maximum of 150 sheets of 20 Ib 75 g m plain paper You can use various paper including plain paper To load paper 1 Pull the tray out of the printer 5 Flex the paper sheets back and forth to separate the pages 7 Squeeze the paper length guide and slide in it until it and then fan them while holding one edge Tap the edges lightly touches the end of the paper stack of the stack on a flat surface to even it up Make sure not to overfill the tray and that all four corners are flat in the tray and under the brackets as shown below Overfilling the tray may cause a paper jam NOTE If you want to change the size of the paper in the tray refer to Changing the Size of the Paper in the Tray on page 2 5 NOTE After you load paper you need to set up your printer I for the paper type size and source you loaded For details see the Softwar
111. ue or rename it by manually editing the etc printcap file I just installed this package but can t find entries in the KDE Gnome menus Some versions of the KDE or GNOME desktop environments may require that you restart your session for the changes to take effect I get a Some options are not selected error message while editing the printer settings Some printers have conflicting settings meaning that some settings for two options can t be selected at the same time When you change a setting and the Printer Package detects such a conflict the conflicting option is changed to a No Choice value You have to choose an option that does not conflict before being able to submit the changes The N up setting does not work correctly for some of my documents The N up feature is achieved through post processing of the PostScript data that is sent to the printing system However such post processing can only be adequately achieved if the PostScript data conforms to the Adobe Document Structing Conventions Problems may arise when using N up and other features that rely on post processing if the document being printed isn t compliant I am using BSD lpr Slackware Debian older distributions and some options chosen in LLPR don t seem to take effect Legacy BSD lpr systems have a hard limitation on the length of the option string that can be passed to the printing system As such if you selec
112. ur printer model You can select the printing resolution The higher the setting the sharper the clarity of printed characters and graphics The higher setting also may increase the time it takes to print a document Colour Mode You can set the colour options Setting to Colour typically produces the best possible print quality for colour documents If you want to print a colour document in Black amp White select Black amp White 25 Printing Multiple Pages on One Sheet of Paper You can print more than one page on a single sheet of paper This feature provides a cost effective way to print draft pages 1 From your Macintosh application select Print from the File menu 2 Select Layout Printer HE Presets Standard E Layout Q C Preview Save As PDF Fax Cancel A Mac OS 10 3 3 Select the number of pages you want to print on one sheet of paper on the Pages per Sheet drop down list 4 Select the page order from the Layout Direction option To print a border around each page on the sheet select the option you want from the Border drop down list 5 Click Print and the printer prints the selected number of pages on one side of each page Software section Index A advanced printing use 10 B booklet printing 11 D document print Macintosh 24 Windows 5 double sided printing 12 Extras properties set 9 F favorites settings use 9
113. vice representative Print a demo page to verify that the printer is feeding paper correctly See 2 7 If a demo page does not print check the paper supply in the tray If the paper jams in the printer go to Clearing Paper Jams on page 6 3 Check the demo page to see if it is printed correctly If there is a print quality problem go to Solving Print Quality Problems on page 6 5 Print a short document from a software application to verify that the computer and printer are connected and communicating correctly e If the page does not print check the cable connection between the printer and the computer Check the print queue or print spooler to see if the printer has been paused Check the software application to ensure that you are using the proper printer driver and communication port If the page is interrupted during printing go to Solving General Printing Problems on page 6 2 If completing the checklist does not resolve the printer problem check the following troubleshooting sections See Solving General Printing Problems on page 6 2 See Solving Print Quality Problems on page 6 5 e See Common Windows Problems on page 6 8 e See Common Macintosh Problems on page 6 8 See Common Linux Problems on page 6 9 Solving Problems Problem The printer does not print Possible Cause The printer is not receiving power Solving Gener
114. what the driver tells the printer about how to image the text in your document Select the appropriate setting according to the status of your document This option may be available only in Windows 9x Me depending on your particular printer model Download as Bit Image When this option is selected the driver will download the font data as bitmap images Documents with complicated fonts such as Korean or Chinese or various other fonts will print faster in this setting Print as Graphics When this option is selected the driver will download any fonts as graphics When printing documents with high graphic content and relatively few TrueType fonts printing performance speed may be enhanced in this setting e Print All Text Black When the Print All Text Black option is checked all text in your document prints solid black regardless of the colour it appears on the screen Darken Text When the Darken Text option is checked all text in your document is allowed to print darker than on a normal document Other Features Tab You can select output options for your document See Printing a Document on page 5 for more information about accessing the printer properties Click the Other Features tab to access the following feature 3 I 2 Xerox Phaser 6110 Printing Preferences Beg Layout Paper Graphics Other Features Troubleshooting

Download Pdf Manuals

image

Related Search

Related Contents

DV-DH1000W/DH500W/DH250W/DH160W 取扱説明書 操作編  American Standard Ranaissance El Total Toilet 2446 User's Manual  REFUS DES HEURES SUPPLÉMENTAIRES : Mode d`emploi  KitchenAid KFGS530ESS Installation Guide  Mode d`emploi de la Wii  L`ART DU RAVISSEMENT LE RAVISSEMENT DE L`ART  FRI-0185 取扱説明書  Woodstock ACCU-SHARP D3978 User's Manual  Philips MCD135  仕様書  

Copyright © All rights reserved.
Failed to retrieve file