Home

HP Probook LJ475UT User's Manual

Contents

1. a 69 Using firewall SOMWaAMEC Ju l i arnir aR EEEE E EES 69 Installing an optional security Cable I n n n 70 TI BACKUND In ROCOVOIY uU ll E a ss 71 Performing a system recovery s nrasnnsnssssssssssssssssssa 72 Backing up your information u UL ULU eiaa aana a a i ia aa a aE 73 12 Computer Seip LL uu uyu n u u aaa E aa aaa a aaa aaa a Daaa aada 74 Starting Computer Setup a a 74 Using Computer Set D unu ua s ua aaa a ua M a kpi Sua aaaea aa Aaea 74 Navigating and selecting in Computer Setup a 74 Restoring factory settings in Computer Setup u 75 Updating the BIOS uuu aus o AA EEAO 75 Determining the BIOS Version 2 ceccteceeeecceneeeeeeeeeeneteseeeeeeeetiesedeascenstesqeeeeenstedeeeeseanie 76 Downloading a BIOS update ua e entire kE E R 76 Appendix A Troubleshooting and suppor ULU aaO REPON EINES SEAE REREN iais 77 Troubleshooting uuu Rau au inae EAEE RE 77 The computer is unable to Start up r rrsssssssssssss 77 The computer screen is blank a 77 Software is functioning abnormally u u etree ANAE REANA EAEEREN 78 The computer is on but not responding ccccecceeeceeeeeeeeeeeeeeeeeeeeeeeeeeteeeeceeeeeeteneeneaeees 78 The computer is unusually Warmi LIL IILI
2. e Amber The computer is connected to external power and the battery is 0 to 90 charged e Blinking amber A battery that is the only available power source has reached a low battery level When the battery reaches a critical battery level the battery light begins blinking rapidly e Off The battery is fully charged NOTE If the computer is plugged into an external power source the light turns off when all batteries in the computer are fully charged If the computer is not plugged into an external power source the light stays off until the battery reaches a low battery level 3 Power connector Connects an AC adapter 4 Vent Enables airflow to cool internal components NOTE The computer fan starts up automatically to cool internal components and prevent overheating It is normal for the internal fan to cycle on and off during routine operation 5 ID External monitor port Connects an external VGA monitor or projector 6 s r RJ 45 network jack Connects a network cable 7 HOMI HDMI port Connects an optional video or audio device such as a high definition television or any compatible digital or audio component 10 Chapter2 Getting to know your computer Component Description 8 ExpressCard slot Reads and writes to ExpressCards 9 USB port Connects an optional USB device 9 g p p 10 USB port Connects an optional USB device 10 g p p Left 11 Display Component
3. inserting 57 removing 58 removing insert 57 ExpressCard slot identifying 11 external devices 60 external drive 60 external monitor port 10 33 F firewall 18 fn key identifying 6 7 22 24 function keys identifying 6 7 H hard drive external 60 Index 87 installing 49 removing 47 hard drive bay identifying 13 HDMI 34 HDMI port identifying 10 Hibernation exiting 37 initiated during critical battery level 42 initiating 37 high definition devices connecting 34 hotkeys adjusting volume 23 audio CD DVD or BD controls 23 battery charge 23 decrease screen brightness 23 description 22 increase screen brightness 23 muting speaker sound 23 QuickLock 23 Suspend 23 switching screen image 23 using 22 hubs 58 l icons network 16 wired network 16 wireless 16 input power 84 integrated numeric keypad identifying 7 25 integrated webcam light identifying 12 internal display switch 12 internal microphones identifying 12 Internet connection setup 17 issues resolving 77 J jacks audio in microphone 8 audio out headphone 8 network 10 88 Index RJ 11 modem 9 RJ 45 network 10 K keyboard hotkeys identifying 22 keypad embedded numeric 6 keypad external num lock 26 using 26 keypad integrated numeric 7 keypads identifying 24 25 keys computer 6 7 esc 6 fn 6 7 24 function 6 7 menu 6 7 numlk_ 6 7 volume 31 L labels Bluetooth 82 regulatory 82 serialnumber 82 SIM 82 w
4. Description 1 Speakers 2 Produce sound 2 Internal display switch Turns off the display or initiates Suspend if the display is closed while the power is on NOTE The display switch is not visible from the outside of the computer 3 WWAN antennas 2 select models only Send and receive wireless signals to communicate with wireless wide area networks WWAN 4 WLAN antennas 2 Send and receive wireless signals to communicate with wireless local area networks WLAN 5 Internal microphone s 1 or 2 depending on Record sound model 6 Webcam light select models only On The webcam is in use 7 Webcam select models only Records video and captures still photographs The antennas are not visible from the outside of the computer For optimal transmission keep the areas immediately around the antennas free from obstructions To see wireless regulatory notices refer to the section of the Regulatory Safety and Environmental Notices that applies to your country or region 12 Chapter 2 Getting to know your computer Bottom Component 1 A Battery and access cover release latches Description Release the battery from the battery bay and release the access cover from the computer 2 Battery bay Holds the battery 3 SIM slot Contains a wireless subscriber identity module SIM select models only The SIM slot is located inside the battery bay 4 Vents 2 Enable
5. It is normal for the computer to feel warm to the touch while it is in use But if the computer feels unusually warm it may be overheating because a vent is blocked If you suspect that the computer is overheating allow the computer to cool to room temperature Be sure to keep all vents free from obstructions while you are using the computer A WARNING To reduce the possibility of heat related injuries or of overheating the computer do not place the computer directly on your lap or obstruct the computer air vents Use the computer only on a hard flat surface Do not allow another hard surface such as an adjoining optional printer or a soft surface such as pillows or rugs or clothing to block airflow Also do not allow the AC adapter to contact the skin or a soft surface such as pillows or rugs or clothing during operation The computer and the AC adapter comply with the user accessible surface temperature limits defined by the International Standard for Safety of Information Technology Equipment IEC 60950 amp NOTE The fan in the computer starts up automatically to cool internal components and prevent overheating It is normal for the internal fan to cycle on and off during operation An external device is not working Follow these suggestions if an external device does not function as expected e Turn on the device according to the manufacturer s instructions e Be sure that all device connections are secure e Be sure that the de
6. More Applications gt Tools gt Backup Manager Settings and then click the Backup my home directory button 2 Click the Storage Destination Location dialog box menu and select a location to back up your information 3 Click the Schedule dialog box menu and select a time schedule to perform backups at a regularly scheduled time To immediately back up your information click the Backup Now check box Z NOTE Before you back up your information be sure you have designated a location to save the backup files 4 Click the Save and Backup button to start the backup and to save the backup settings To restore backup files 1 Select Computer gt More Applications gt Tools gt Backup Manager Restore 2 Click the Backup Source dialog box menu and select the location of the backup files 3 Click the Restore Destination dialog box menu and select the destination to restore the files 4 To restore all files from the selected location click the Restore all files button To restore selective files only click the Restore selected files button and then click the Select Files button and select the files to be restored 5 Under Restore Point click the time and date of the backup Z NOTE If multiple backups have been performed click the Use the latest version button to restore the latest version 6 Click the Restore button to start restoring the files or click the Cancel button to cancel the operation Backin
7. NOTE Press fn f4 to switch the image between the display devices connected to the computer 34 Chapter5 Multimedia Configuring audio for HDMI select models only To configure HDMI audio first connect an audio or video device such as a high definition TV to the HDMI port on your computer Then configure the default audio playback device as follows 1 Right click the Speakers icon in the notification area at the far right of the taskbar and then click Open Volume Control 2 On the Output Devices tab click the HDMI audio device 3 Click the down arrow and then click Default To return audio to the computer speakers follow these steps 1 Right click the Speakers icon in the notification area at the far right of the taskbar and then click Open Volume Control 2 On the Output Devices tab click Analog audio device 3 Click the down arrow and then click Default NOTE You can also right click the audio device listed in the dialog box and then click Default Using video devices 35 6 Power management The following sections are included in this chapter ry Shutting down the computer e Setting power options e Using battery power e Using external AC power Shutting down the computer A CAUTION Unsaved information will be lost when the computer is shut down The shut down command closes all open programs including the operating system and then turns off the display and computer S
8. When you disconnect external AC power the following events occur e The computer switches to battery power e The display brightness is automatically decreased to save battery life 44 Chapter6 Power management Testing an AC adapter Test the AC adapter if the computer exhibits any of the following symptoms when it is connected to AC power e The computer does not turn on e The display does not turn on e The power light is off To test the AC adapter 1 Shut down the computer 2 Remove the battery from the computer 3 Connect the AC adapter to the computer and then plug it into an AC outlet 4 Turn on the computer e lfthe power light turns on the AC adapter is functioning properly e lfthe power light remains off the AC adapter is not functioning and should be replaced Contact technical support for information on obtaining a replacement AC power adapter Using external AC power 45 7 Drives The following sections are included in this chapter Handling drives Replacing or upgrading the hard drive Using optical drives select models only Handling drives Drives are fragile computer components that must be handled with care Refer to the following cautions before handling drives Additional cautions are included with the procedures to which they apply Observe these precautions Before you move a computer that is connected to an external hard drive initiate Suspend and allow the screen to clear or
9. aaa asss taaeeeeeeeetaeeeeeeeeniaeeeeeeees 78 An external device is not working o 2 cccccecececeetecasdeeceetesansdenecensaneessetecesseneveneteadenensnenaeeas 78 The wireless network connection is NOt working eee eeeetneee eee taaeeeeeetnaeeeeeee 79 The optical disc tray does not open for removal of a CD or DVD 79 The computer does not detect the optical drive 80 Adec COGS NOE PlAY xu u uuu masatu kaha musyaq kamayka usasapa bos 80 A movie is not visible on an external display u 80 The process of burning a disc does not begin or it stops before completion 81 Contacting c stomer support u a Thu k ads ene etd eters 81 EabpelSuu o Sanu a sao muya us uma ya ya aasan a usay a Sha sss 82 viii Appendix B Cleaning your COMPUTE IILI sas iaaii aaa aaa iaaa iiai 83 Cleaning PRODUCES U T T T a uykamakku yuta aha 83 APPS O BSOSCHICAUONS csutak nnan nai aeiiae iaia aaaeaii aai aeaa a akaa 84 Input POWET a LL N au Q ausnkas talecbacdecadasdacenscdsaaaaasuslaas hanes sateadunoeaguncdecseteanerceuanaacndes 84 Operating environm ent riirii aia aaa aa n de hi C a a dee 85 Appendix D Electrostatic discharge uu L IA l I Saa AER EEN EEEE Ka ERR AN 86 Jim l E m uu ws DS 22 87 1 Welcome The following section is included in this chapter Finding information After y
10. airflow to cool internal components 5 Hard drive bay NOTE The computer fan starts up automatically to cool internal components and prevent overheating It is normal for the internal fan to cycle on and off during routine operation Contains the hard drive the wireless LAN module slot and the memory module slot CAUTION To prevent an unresponsive system replace the wireless module only with a wireless module authorized for use in the computer by the governmental agency that regulates wireless devices in your country or region If you replace the module and then receive a warning message remove the module to restore computer functionality Bottom 13 3 Networking The following sections are included in this chapter e Using an Internet service provider ISP e Identifying wireless and network status icons e Creating a wireless connection e Using a WLAN Using Bluetooth wireless devices select models only e Connecting to a wired network Your computer may support one or both of the following types of Internet access e Wireless For mobile Internet access you can use a wireless connection Refer to Connecting to an existing WLAN on page 17 or Setting up a new WLAN on page 17 e Wired You can access the Internet by connecting to a wired network For information on connecting to a wired network refer to Connecting to a wired network on page 19 Z NOTE Internet hardware and software feature
11. e Using Digital Media Slot cards select models only e Using ExpressCards select models only e Using a USB device e Using optional external devices Using Digital Media Slot cards select models only Optional digital cards provide secure data storage and convenient data sharing These cards are often used with digital media equipped cameras and PDAs as well as with other computers To determine which digital card formats that are supported on your computer refer to Getting to know your computer on page 3 Inserting a digital card A CAUTION To reduce the risk of damage to the digital card connectors use minimal force to insert a digital card 1 Hold the digital card label side up with the connectors facing the computer 2 Insert the card into the Digital Media Slot and then push in on the card until it is firmly seated a 54 Chapter 8 External cards and devices Removing a digital card A CAUTION To reduce the risk of loss of data or an unresponsive system use the following procedure to safely remove the digital card Save your information and close all programs associated with the digital card To remove a digital card 1 Open File Browser by selecting Computer gt Nautilus 2 Click the Eject icon next to the name of the digital card in the Places list on the left pane of File Browser f NOTE You are prompted that it is safe to remove the hardware device 3 Either press
12. follow the same procedure you used initially to connect to your WLAN 18 Chapter 3 Networking Using Bluetooth wireless devices select models only A Bluetooth device provides short range wireless communications that replace the physical cable connections that traditionally link electronic devices such as the following e Computers Phones e Audio devices The strength of Bluetooth is in synchronizing information transfers between your computer and wireless devices The inability to consistently connect two or more computers to share the Internet through Bluetooth is a limitation of Bluetooth and the operating system Bluetooth devices provide peer to peer capability that allows you to set up a personal area network PAN of Bluetooth devices For information on configuring and using Bluetooth devices refer to the Bluetooth software Help Connecting to a wired network Using a modem select models only A modem must be connected to an analog telephone line using a 6 pin RJ 11 modem cable purchased separately In some countries or regions a specific modem cable adapter is also required Jacks for digital PBX systems may resemble analog telephone jacks but they are not compatible with the modem A WARNING To reduce the risk of electric shock fire or damage to the equipment do not plug a modem or telephone cable into the RJ 45 network jack If the modem cable contains noise suppression circuitry 1 which prevents interf
13. hard drive All files you have created and any software installed on the computer are permanently removed The recovery tool reinstalls the original operating system and HP programs and drivers that were installed at the factory Software drivers and updates not installed by HP must be manually reinstalled Personal files must be restored from a backup To restore the computer from the partition follow these steps 1 If possible back up all personal files 2 Restart the computer 3 Using the arrow keys select Recovery and then press enter 4 Follow the on screen instructions NOTE If you are unable to boot start up your computer from the hard drive partition with the primary operating system or from the recovery partition you must purchase a SUSE Linux Enterprise Desktop Operating System DVD to reinstall the operating system For additional information refer to the Worldwide Telephone Numbers booklet 72 Chapter 11 Backup and Recovery Backing up your information You should back up your computer files on a regular schedule to maintain a current backup You can manually back up your information to an optional external drive a network drive or discs Back up your system at the following times e At regularly scheduled times e Before the computer is repaired or restored e Before you add or modify hardware or software To back up your home directory files using Backup Manager Settings 1 Select Computer gt
14. in this guide does not address your questions you can contact HP Customer Support at http Awww hp com go contactHP f NOTE For worldwide support click Contact HP worldwide on the left side of the page or go to http welcome hp com country us en wwcontact_us html Here you can Chat online with an HP technician amp NOTE When technical support chat is not available in a particular language it is available in English e E mail HP Customer Support e Find HP Customer Support worldwide telephone numbers Locate an HP service center Contacting customer support 81 Labels The labels affixed to the computer provide information you may need when you troubleshoot system problems or travel internationally with the computer e Serial number label Provides important information including the following ap ol et Product XXXXXXXX MOO Warrant ly lyOy _ Model 200000KX Component 1 Product name 2 Serial number s n 3 Part number product number p n 4 Warranty period 5 Model description Have this information available when you contact technical support The serial number label is affixed inside the battery bay e Regulatory label Provides regulatory information about the computer The regulatory label is affixed inside the battery bay e Wireless certification label or labels select models only Provide information about optional w
15. or use the up arrow key or the down arrow key e Toclose open dialog boxes and return to the main Computer Setup screen press esc and then follow the on screen instructions f NOTE You can use either a pointing device TouchPad pointing stick or USB mouse or the keyboard to navigate and make selections in Computer Setup 2 Press f10 to enter Computer Setup 74 Chapter 12 Computer Setup To exit Computer Setup menus choose one of the following methods To exit Computer Setup menus without saving your changes click the Exit icon in the lower left corner of the screen and then follow the on screen instructions Use the tab key and the arrow keys to select File gt Ignore Changes and Exit and then press enter To save your changes and exit Computer Setup menus click the Save icon in the lower left corner of the screen and then follow the on screen instructions Use the tab key and the arrow keys to select File gt Save Changes and Exit and then press enter Your changes go into effect when the computer restarts Restoring factory settings in Computer Setup Ef NOTE Restoring defaults will not change the hard drive mode To return all settings in Computer Setup to the values that were set at the factory follow these steps 1 So S UP Turn on or restart the computer and then press esc while the Press the ESC key for Startup Menu message is displayed at the bottom of the screen Press f10
16. recovery 71 regulatory information regulatory label 82 wireless certification labels 82 release latches access cover 13 battery 13 40 RJ 11 modem jack identifying 9 RJ 45 network jack identifying 10 s screen brightness keys 23 screen image switching 23 scrolling TouchPad gesture 28 security cable 70 security cable slot identifying 10 security wireless 18 serial number computer 82 setup of WLAN 17 setup utility navigating and selecting 74 restoring factory settings 75 shut down 36 SIM slot identifying 13 slots ExpressCard 11 security cable 10 SIM 13 speakers identifying 12 storing battery 43 Suspend exiting 37 initiating 37 T temperature 43 TouchPad buttons 4 identifying 26 setting preferences 28 TouchPad gestures pinching 28 scrolling 28 zooming 28 TouchPad light 4 TouchPad on off button 3 TouchPad identifying 3 traveling with the computer 43 82 tray load optical drive 51 troubleshooting disc burning 81 disc play 80 external display 80 optical disc tray 79 optical drive detection 80 turning off the computer 36 U unresponsive system 36 USB cable connecting 59 USB devices connecting 59 description 58 removing 59 USB hubs 58 USB legacy support 74 USB port identifying 11 USB ports identifying 9 58 V vents identifying 10 13 VGA port connecting 33 video using 33 volume adjusting 31 buttons 31 keys 31 volume keys identifying 23 w Web browser button iden
17. the Network Connection icon and select Connect to Hidden Wireless Network Enter the ESSID information and set encryption parameters NOTE If no WLANs are listed and your network is not hidden you are out of range of a wireless router or access point If you do not see the network you want to connect to right click the Network Connection icon in the notification area at the far right of the taskbar and click Edit Connections Setting up a new WLAN Required equipment e A broadband modem either DSL or cable 1 and high speed Internet service purchased from an Internet service provider ISP e A wireless router purchased separately 2 e The wireless computer 3 The illustration below shows an example of a wireless network installation that is connected to the Internet NOTE Some cable modems include a built in router Check with your ISP to see if you need a separate router NOTE When setting up a wireless connection be sure that your computer and wireless router are synchronized To synchronize your computer and wireless router turn your computer and wireless router off and then back on As your network grows additional wireless and wired computers can be connected to the network to access the Internet Using a WLAN 17 For help in setting up your WLAN refer to the information provided by your router manufacturer or your ISP Protecting your WLAN When you set up a WLAN or access an existing W
18. through the Control Center or Computer Setup Z NOTE Referto Getting to know your computer on page 3 for information on identifying the location of the wireless button on your computer Using the operating system controls To enable or disable a wireless or wired network device 1 Right click the Network Connection icon in the notification area at the far right of the taskbar 2 Toenable or disable one of the following devices select or clear one of the following options e Enable Networking all network devices Enable Wireless Using a WLAN A wireless connection connects the computer to Wi Fi networks or WLANs A WLAN is composed of other computers and accessories that are linked by a wireless router or a wireless access point 16 Chapter3 Networking Connecting to an existing WLAN 1 Be sure that the WLAN device is on amp NOTE Refer to Getting to know your computer on page 3 for information on identifying the location of the wireless button and wireless light on your computer 2 Click the Network Connection icon in the notification area at the far right of the taskbar Available wireless networks are listed under Wireless Networks 3 Click the desired wireless network If the network is a security enabled WLAN you are prompted to enter a network security code Type the code and then click OK to complete the connection amp NOTE To connect to a network that is not automatically detected click
19. to enter Computer Setup Use a pointing device or the arrow keys to select File gt Restore Defaults Follow the on screen instructions To save your changes and exit click the Save icon in the lower left corner of the screen and then follow the on screen instructions Use the arrow keys to select File gt Save Changes and Exit and then press enter Your changes go into effect when the computer restarts NOTE Your password settings and security settings are not changed when you restore the factory settings Updating the BIOS Updated versions of the BIOS may be available on the HP Web site Most BIOS updates on the HP Web site are packaged in compressed files called SoftPaqs Some download packages contain a file named Readme txt which contains information regarding installing and troubleshooting the file Updating the BIOS 75 Determining the BIOS version To determine whether available BIOS updates contain later BIOS versions than those currently installed on the computer you need to know the version of the system BIOS currently installed BIOS version information also known as ROM date and System BIOS can be displayed by using Computer Setup 1 Start Computer Setup 2 Use a pointing device or the arrow keys to select File gt System Information BIOS and other system information is displayed 3 To exit Computer Setup click the back arrow or use the arrow keys to select File gt Ignore Changes and Exit
20. 8 m 50 ft to 10 000 ft Nonoperating 15 m to 12 192 m 50 ft to 40 000 ft Operating environment 85 D Electrostatic discharge Electrostatic discharge is the release of static electricity when two objects come into contact for example the shock you receive when you walk across the carpet and touch a metal door knob A discharge of static electricity from fingers or other electrostatic conductors may damage electronic components To prevent damage to the computer damage to a drive or loss of information observe these precautions If removal or installation instructions direct you to unplug the computer unplug it after being properly grounded and before removing a cover Keep components in their electrostatic safe containers until you are ready to install them Avoid touching pins leads and circuitry Handle electronic components as little as possible Use nonmagnetic tools Before handling components discharge static electricity by touching an unpainted metal surface of the component If you remove a component place it in an electrostatic safe container If you need more information about static electricity or assistance with component removal or installation contact Customer Support 86 AppendixD Electrostatic discharge Index A AC adapter light 10 access cover removing 47 62 replacing 47 49 64 access cover release latches 13 action keys volume 31 administrator password creating 68 entering 68 m
21. HP Notebook User Guide Copyright 2011 Hewlett Packard Development Company L P Bluetooth is a trademark owned by its proprietor and used by Hewlett Packard Company under license SD Logo is a trademark of its proprietor The information contained herein is subject to change without notice The only warranties for HP products and services are set forth in the express warranty statements accompanying such products and services Nothing herein should be construed as constituting an additional warranty HP shall not be liable for technical or editorial errors or omissions contained herein Second Edition April 2011 First Edition March 2011 Document Part Number 643395 002 Product notice This guide describes features that are common to most models Some features may not be available on your computer To obtain the latest information in this guide go to the HP Web site at http www hp com support Software terms By installing copying downloading or otherwise using any software product preinstalled on this computer you agree to be bound by the terms of the HP End User License Agreement EULA If you do not accept these license terms your sole remedy is to return the entire unused product hardware and software within 14 days for a refund subject to the refund policy of your place of purchase For any further information or for requesting a full refund of the computer please contact your local point of sa
22. LAN always enable security features to protect your network from unauthorized access WLANs in public areas hotspots like coffee shops and airports may not provide any security If you are concerned about the security of your computer in a hotspot limit your network activities to e mail that is not confidential and basic Internet surfing Wireless radio signals travel outside the network so other WLAN devices can pick up unprotected signals You can use the following precautions to protect your WLAN e Use Firewall Checks both data and requests for data that are sent to your network and discards any suspicious items Firewalls are available in both software and hardware Some networks use a combination of both types e Encrypt your data Wi Fi Protected Access WPA and WPA2 encrypts and decrypts data transmitted over the network WPA uses Temporal Key Integrity Protocol TKIP to dynamically generate a new key for every packet It also generates different sets of keys for each computer on the network Wired Equivalent Privacy WEP encrypts data before it is transmitted using a WEP key Without the correct key others will not be able to use the WLAN Roaming to another network When you move your computer within range of another WLAN the operating system attempts to connect to that network If the attempt is successful your computer is automatically connected to the new network If the operating system does not recognize the new network
23. No After you click No the computer may behave in either of the following ways Playback may resume The playback window in the multimedia program may close To return to playing the disc click the Play button in your multimedia program to restart the disc In rare cases you may need to exit the program and then restart it A movie is not visible on an external display 1 2 If both the computer display and an external display are turned on press fn f4 one or more times to switch between the 2 displays Configure the monitor settings to make the external display primary a Right click on a blank area of the computer desktop and select Screen resolution b Specify a primary display and a secondary display f NOTE When using both displays the DVD image will not appear on any display designated as the secondary display 80 AppendixA Troubleshooting and support The process of burning a disc does not begin or it stops before completion e Be sure that all other programs are closed e Turn off Suspend mode and Hibernation e Be sure that you are using the right kind of disc for your drive e Be sure that the disc is inserted properly e Select a slower write speed and try again e f you are copying a disc save the information on the source disc to your hard drive before trying to burn the contents to a new disc and then burn from your hard drive Contacting customer support If the information provided
24. Password field and then press enter 4 times To save your changes and exit Computer Setup use the arrow keys to select Exit gt Exit Saving Changes Your changes take effect when the computer restarts Entering an administrator password At the Enter password prompt type your administrator password and then press enter After 3 unsuccessful attempts to enter the administrator password you must restart the computer and try again Managing a power on password To set change or delete this password follow these steps 1 Open Computer Setup by turning on or restarting the computer While the Press the ESC key for Startup Menu message is displayed in the lower left corner of the screen press esc When the Startup Menu is displayed press f10 Use the arrow keys to select Security gt Set Power On Password and then press enter e To seta power on password type your password in the Enter New Password and Confirm New Password fields and then press enter e To change a power on password type your current password in the Enter Current Password field type a new password in the Enter New Password and Confirm New Password fields and then press enter e To delete a power on password type your current password in the Enter Current Password field and then press enter 4 times To save your changes and exit Computer Setup use the arrow keys to select Exit gt Exit Saving Changes Your changes take effect when the co
25. aa eee E OT TAE 43 Disposing of a used battery l eee eee aaa 44 Replacing ihe ballery uuu uuu sl au ulus oasasasapukasgasnaansaqaqhssanqasahaksasayuka awbarqakkaya 44 Using extemal AG B6WOr u u uuu diniinan ain a EERENS EEEE TN 44 Testing an AC adapter UU U U U u u 45 T Wikus aS 46 Fandling JiVe S LL u LLIK awak wakaqa saki habe N EEEE EEEE AANEEN EEEE ENE 46 Replacing or upgrading the hard drive U U U UU u u 47 Removing the hard grigu u renani raanei inan iN EARE Wlalddeabverdiaaeaneedecs 47 instaliga bard die uuu u uu l u k Qu N N 49 Using optical drives select models only U U u u 51 Identifying the installed Optical drive u a 51 INSEMING AM optiealidiegk uuu ul u at haquniussmanayishasqhassaikaypawsahakaqa 51 Tray load eas OA 51 Removing an optical disc U U U U U u u uu 51 Tray loa u i a T EATA EARE 51 When the disc tray opens normally ccceeeeeeeeeeeeeeeeeeenetteeeeeeees 52 When the disc tray fails to open 0 ee ceeeeeeeeeteeeeeeeteeeenteaaeeeeeees 52 8 External cards Aine devices uuu aa IN A A 54 Using Digital Media Slot cards select models only I a 54 Inserting a digital Cand 2 ccs iitecetiieclla ieee EEE E TERE 54 Removing g digital Card uuu um secrete eee hades ed Gans dade e
26. about using your webcam click the Help menu in the Cheese software 32 Chapter5 Multimedia Using video devices Your computer may have one or more of the following external video ports e VGA e HDMI VGA The external monitor port or VGA port is an analog display interface that connects an external VGA display device such as an external VGA monitor or a VGA projector to the computer A To connect a VGA display device connect the device cable to the external monitor port ICI amp NOTE Press fn f4 to switch the image between the display devices connected to the computer Using video devices 33 Connecting an HDMI device select models only The HDMI High Definition Multimedia Interface port connects the computer to an optional video or audio device such as a high definition television or to any compatible digital or audio component NOTE To transmit video signals through the HDMI port you need an HDMI cable purchased separately One HDMI device can be connected to the HDMI port on the computer The information displayed on the computer screen can be simultaneously displayed on the HDMI device To connect a video or audio device to the HDMI port 1 Connect one end of the HDMI cable to the HDMI port on the computer HDMI amp a 2 Connect the other end of the cable to the video device and then refer to the device manufacturer s instructions for additional information
27. adap pauslacoul a ueddantansadilad tebe tisatennyedsdsdeeaagaundaanea aeudanngelscadsaysanideensaeabatine aeledace east 10 DIS NAY cae u unu uu a una m Da u u u us 12 BOOM s l usapu adie isin EATE E 13 3 WRN ONE UA GS uui u 5222 usa Sa au aw fia eeicdaa ee x Kanieaa se etawmea oii 14 Using an Internet service provider ISP a U U u u 15 Identifying wireless and network status icons eee tenet ee eeeeaeeeeeeetaeeeeeeeaaeeeeeteeaeeeeeeaas 16 Creating a wireless COMMGCUON LLL nnna ni EEEE EAEE 16 Turning wireless devices on and olf U u u u 16 Using the wireless button U U u uu 16 Using the operating system controls 16 Using a wLANuiu n u um Zn Qaqaqa A E anda aeeaieladanevdndaas 16 Connecting to an existing WLAN n 17 Setting up a new WLAN LL U uu aasan n EEE EE RAEE ERRES 17 Protecting your WLAN uuu luas aalunaaqaqabahaasdhuqa ykayaqaqawaQunaqaaqaqaswaaqasqaqa 18 PBoarming io3anolernelWork LU u T 18 Using Bluetooth wireless devices select models only u a 19 Connecting to a wired Network I n n nar 19 Using a modem select models only J aaa ssassasa saa Nn enini Nnnn EEEE 19 Connecting a modem Cable swevesscsssiecgansesdeseeadsdeyevvenudeesguevdaldenyvesdacst
28. also be controlled through the operating system and some programs NOTE Refer to Getting to know your computer on page 3 and Keyboard and pointing devices on page 22 for information on what type of volume controls your computer has Using the audio features 31 Checking your audio functions To check the system sound on your computer follow these steps 1 Select Computer gt Control Center 2 Click Sound 3 Select the Devices tab and then click the Test button in order to test each sound To check the recording functions of the computer follow these steps 1 Select Computer gt Control Center 2 Click the Devices tab and then click the Test button next to Sound capture f NOTE For best results when recording speak directly into the microphone and record sound in a setting free of background noise To confirm or change the audio settings on your computer right click the Sound icon in the notification area at the far right of the taskbar Using the Webcam select models only Some computers include an integrated webcam located at the top of the display With the preinstalled software Cheese you can use the webcam to take a photo or record a video You can preview and save the photo or video recording The webcam software enables you to experiment with the following features e Capturing and sharing video e Streaming video with instant message software e Taking still photos 99 Ef NOTE For details
29. anaging 68 airport security devices 47 audio features 30 audio functions checking 32 audio in microphone jack 8 audio out headphone jack 8 B backup 71 battery charging 41 conserving power 43 disposing 44 inserting 40 life 42 low battery levels 42 power 38 removing 40 storing 43 temperature 43 battery bay 13 82 battery release latches 13 40 BIOS determining version 76 downloading an update 76 updating 75 Bluetooth device 19 Bluetooth label 82 buttons left TouchPad 4 optical drive eject 9 power 5 right TouchPad 4 TouchPad on off 3 volume 31 Web browser 5 wireless 5 C cables LAN 21 USB 59 caps lock light identifying 4 charging batteries 41 checking audio functions 32 cleaning your computer 83 components bottom 13 display 12 front 8 left side 10 right side 9 top 3 computer key identifying 6 7 Computer Setup navigating and selecting 74 passwords setin 67 restoring factory settings 75 configuring ExpressCards 56 connecting toa WLAN 17 conservation power 43 corporate WLAN connection 17 critical battery level 42 D digital card defined 54 inserting 54 removing 55 stopping 55 display image switching 23 drive light 8 drive media 37 drives external 60 handling 46 hard 60 optical 9 60 E electrostatic discharge 86 embedded numeric keypad identifying 6 24 entering a power on password 69 entering an administrator password 68 ExpressCard configuring 56 defined 56
30. apped in the scratches Cleaning products 83 C Specifications The following sections are included in this appendix e Input power e Operating environment Input power The power information in this section may be helpful if you plan to travel internationally with the computer The computer operates on DC power which can be supplied by an AC or a DC power source The AC power source must be rated at 100 240 V 50 60 Hz Although the computer can be powered from a standalone DC power source it should be powered only with an AC adapter or a DC power source supplied and approved by HP for use with this computer The computer can operate on DC power within the following specifications Input power Rating Operating voltage and current 18 5 V dc 3 5 A 65W 19 0 V dc 4 74 A 90W Z NOTE This product is designed for IT power systems in Norway with phase to phase voltage not exceeding 240 V rms NOTE The computer operating voltage and current can be found on the system regulatory label inside the battery bay 84 Appendix C Specifications Operating environment Factor Metric U S Temperature Operating writing to optical disc 5 C to 35 C 41 F to 95 F Nonoperating 20 C to 60 C 4 F to 140 F Relative humidity noncondensing Operating 10 to 90 10 to 90 Nonoperating 5 to 95 5 to 95 Maximum altitude unpressurized Operating 15 m to 3 04
31. as been unused for 2 weeks or more or is much warmer or cooler than room temperature To prolong battery life and optimize the accuracy of battery charge displays follow these recommendations e Ifyou are charging a new battery charge it fully before turning on the computer NOTE If the computer is on while the battery is charging the battery meter in the notification area may show 100 percent charge before the battery is fully charged e Allow the battery to discharge below 5 percent of a full charge through normal use before charging it e Ifthe battery has been unused for one month or more calibrate the battery instead of simply charging it Using battery power 41 Maximizing battery life To maximize battery life 1 Select Computer gt Control Center gt Power Management 2 Under the On Battery Power tab e Adjust the slider to the right of Put computer to sleep when inactive for to 30 minutes e Select the Suspend or Hibernate option from the dialog box to the right of When laptop lid is closed e Select the Hibernate or Shutdown option from the dialog box to the right of When battery power is critically low 3 Adjust the slider to the right of Put display to sleep when inactive for to 15 minutes and select the check box next to Reduce backlight brightness 4 Click Close Managing low battery levels The information in this section describes the alerts and system responses set at the factory Some low batter
32. attacks or prevent the computer from being mishandled or stolen Security features provided with your computer can protect the computer personal information and data from a variety of risks The way you use your computer will determine which security features you need to use The operating system offers certain security features Additional security features are listed in the following table Most of these additional security features can be configured in Computer Setup To protect against Unauthorized use of the computer Use this security feature Power on authentication using passwords Unauthorized access to Computer Setup f10 Administrator password in Computer Setup Unauthorized access to the contents of a hard drive DriveLock password in Computer Setup Unauthorized reset of Computer Setup f10 passwords Stringent security feature in Computer Setup Unauthorized startup from an optical drive diskette drive or internal network adapter Boot options feature in Computer Setup Unauthorized access to data Firewall software e Operating system updates Unauthorized access to Computer Setup settings and other system identification information Administrator password in Computer Setup Unauthorized removal of the computer Security cable slot used with an optional security cable Computer Setup is a utility accessed by pressing f10 when the computer is turned on or r
33. ches a critical battery level Power settings and timeouts can be changed using Power Management in Control Center Setting power options 37 With the computer on you can initiate Hibernation in any of the following ways e Briefly press the power button e Select Computer gt Shutdown gt Hibernate e Click the Power icon located on the far right of the taskbar and then click Hibernate To exit Hibernation A Briefly press the power button When the computer exits Hibernation the power light turns on and your work returns to the screen where you stopped working Using the Power icon The Power icon is located in the notification area at the far right of the taskbar The Power icon allows you to quickly access power settings view remaining battery charge and select a different power plan e To display the percentage of remaining battery charge click the Power icon and then click Information e To access Power Management Preferences click the Power icon and then click Preferences Using power management Power management is a collection of system settings that manages how the computer uses power Power management can help you conserve power or maximize performance You can customize power management settings Viewing the current power management settings A Right click the Power icon in the notification area at the far right of the taskbar and then click Preferences Changing the current power management settings 1 R
34. ded in printed format you may request a printed copy at http www hp com go orderdocuments or write to North America Hewlett Packard MS POD 11311 Chinden Blvd Boise ID 83714 USA Europe Middle East Africa Hewlett Packard POD Via G Di Vittorio 9 20063 Cernusco s Naviglio MI Italy e Asia Pacific Hewlett Packard POD P O Box 200 Alexandra Post Office Singapore 911507 Please include your product number warranty period found on your serial number label name and postal address 2 Chapter 1 Welcome 2 Getting to know your computer The following sections are included in this chapter e Top Front Right e Left Display Bottom Top TouchPad Component Description 1 TouchPad on off button Turns the TouchPad on and off 2 TouchPad Moves the pointer and selects or activates items on the screen Top Component Description 3 Left TouchPad button Functions like the left button on an external mouse 4 Right TouchPad button Functions like the right button on an external mouse Component Description 1 TouchPad light e Amber The TouchPad is off e Off The TouchPad is on 2 Caps lock light e White Caps lock is on e Off Caps lock is off 3 Power light e On The computer is on e Blinking The computer is in the Suspend state e Off The computer is off or in Hibernation 4 Web browser light On Launching the Firefox bro
35. e computer 58 Chapter 8 External cards and devices Connecting a USB device A CAUTION To prevent damage to a USB connector use minimal force to connect a USB device A To connect a USB device to the computer connect the USB cable for the device to the USB port d You will hear a sound when the device has been detected amp NOTE When you connect a USB device you may see a message in the notification area to let you know that the device is recognized by the system Removing a USB device A CAUTION To prevent damage to a USB connector do not pull on the cable to remove the USB device CAUTION To prevent loss of information or an unresponsive system use the following procedure to safely remove a USB device To remove a USB device 1 Open File Browser by selecting Computer gt Nautilus 2 Click the Eject icon next to the name of the device in the Places list on the left pane of File Browser 3 Remove the device NOTE You can remove a USB mouse or USB keyboard by unplugging the device from the computer USB storage devices must be disconnected from the computer using the above procedure Using aUSB device 59 Using optional external devices f NOTE For more information about required software and drivers or to learn which computer port to use refer to the manufacturer s instructions To connect an external device to the computer A CAUTION To reduce the risk of damage to th
36. e equipment when connecting a powered device be sure that the device is turned off and the AC power cord is unplugged 1 Connect the device to the computer 2 Ifyou are connecting a powered device plug the device power cord into a grounded AC outlet 3 Turn on the device To disconnect an unpowered external device turn off the device and then disconnect it from the computer To disconnect a powered external device turn off the device disconnect it from the computer and then unplug the AC power cord Using optional external drives Removable external drives expand your options for storing and accessing information A USB drive can be added by connecting the drive to a USB port on the computer NOTE HP external USB optical drives should be connected to the powered USB port on the computer USB drives include the following types e 1 44 megabyte diskette drive e External hard drive a hard drive with an adapter attached e External optical drive CD and DVD e MultiBay device 60 Chapter 8 External cards and devices 9 Memory modules The computer memory module compartment is located on the bottom of the computer A WARNING To reduce the risk of electric shock and damage to the equipment unplug the power cord and remove all batteries before installing a memory module A CAUTION Electrostatic discharge ESD can damage electronic components Before beginning any procedure ensure that you are discharged o
37. eee celia 19 Connecting a country or region specific modem cable adapter 20 Connecting to a local area network LAN select models Only 21 4 Keyboard and pointing devices i ccciscscccctissssesecunsescececcrsnneseteeupsnsestsunsanecseesneseneGesuysenecncounesesseemneres counnesesteernvane 22 Using the keyboard eeeeeeee sete eee caaaeaaaeaaaaeaeceeeeeeeeeeeeeeeeeeeeeeeeeeneees 22 Identifying the MOtkeyS eierne ae dea a aa 22 USING Keypad Srania nanana na aa ae a aaa aia A 24 Using the embedded numeric keypad 24 Turning the embedded numeric keypad on and olff 25 Switching key functions on the embedded numeric keypad 25 Using the integrated numeric keypad a 25 Using an optional external numeric keypad a 26 Using the TouchPad rr 26 Turning the TouchPad off and on 26 NAVIGATING D E E A E 27 Selecting sadacceiicesarcnestecsaasaaseuudenanaadietiasag Saadecuechalaaswlsvabea dian ddcsaadumectueona Suasana Saa 27 Using TouchPad gestures U inn TE ETE 27 SCO Greece Aa a E ener e aan A E eee 28 PINCHING ZOOMING u u u Uka a i a a ai 28 Settin
38. entifying computer components Linux Help e Computer software To access the Linux Help select Computer gt Help e Computer settings e Connecting to the Internet e Computer utilities Regulatory Safety and Environmental Notices e Regulatory and safety information To access the notices click the HP Documents icon e Battery disposal information located on the desktop Safety amp Comfort Guide e Proper workstation setup posture health and work habits To access this guide e Electrical and mechanical safety information Click the HP Documents icon located on the desktop or Go to http www hp com ergo Worldwide Telephone Numbers booklet HP support telephone numbers This booklet is provided with your computer HP Web site e Support information To access this Web site go to http www hp com e Ordering parts and finding additional help support e Software driver and BIOS updates e Accessories available for the device Limited Warranty Warranty information To access the warranty Click the HP Documents icon located on the desktop _ or Go to http www hp com go orderdocuments You may find the expressly provided HP Limited Warranty applicable to your product located with the electronic guides on your computer and or on the CD DVD provided in the box Some countries regions may provide a printed HP Limited Warranty in the box In countries regions where the warranty is not provi
39. er to go Use the left and right TouchPad buttons like the buttons on an external mouse To scroll up and down using the TouchPad vertical scroll zone slide your finger up or down over the lines Z NOTE If you are using the TouchPad to move the pointer you must lift your finger off the TouchPad before moving it to the scroll zone Simply sliding your finger from the TouchPad to the scroll zone does not activate the scrolling function NOTE In addition to the pointing devices included with your computer you can use an external USB mouse purchased separately by connecting it to one of the USB ports on the computer Turning the TouchPad off and on 26 To turn the TouchPad off and on quickly double tap the TouchPad light NOTE The TouchPad light is off when the TouchPad is on Chapter 4 Keyboard and pointing devices Navigating To move the pointer slide one finger across the TouchPad in the direction you want the pointer to go Selecting Use the left and right TouchPad buttons like the corresponding buttons on an external mouse Using TouchPad gestures The TouchPad supports a variety of gestures To use TouchPad gestures place two fingers on the TouchPad at the same time f NOTE TouchPad gestures are not supported in all programs To turn the gestures on and off 1 Select Computer gt Control Center gt TouchPad and then click the Settings button 2 Select the gesture that you want to t
40. erence from TV and radio reception orient the circuitry end of the cable 2 toward the computer Connecting a modem cable 1 Plug the modem cable into the modem jack 1 on the computer Using Bluetooth wireless devices select models only 19 2 Plug the modem cable into the RJ 11 telephone wall jack 2 aYass Connecting a country or region specific modem cable adapter Telephone jacks vary by country or region To use the modem and the modem cable outside the country or region in which you purchased the computer you must obtain a country or region specific modem cable adapter To connect the modem to an analog telephone line that does not have an RJ 11 telephone jack follow these steps 1 Plug the modem cable into the modem jack 1 on the computer 2 Plug the modem cable into the modem cable adapter 2 3 Plug the modem cable adapter 3 into the telephone wall jack 20 Chapter 3 Networking Connecting to a local area network LAN select models only Connecting to a local area network LAN requires an 8 pin RJ 45 network cable purchased separately If the network cable contains noise suppression circuitry 1 which prevents interference from TV and radio reception orient the circuitry end of the cable 2 toward the computer To connect the network cable 1 Plug the network cable into the network jack 1 on the computer 2 Plug the other end of the cable into a network
41. es depending on power management settings programs running on the computer display brightness external devices connected to the computer and other factors You can find details about the battery and device information by clicking the Battery icon in the notification area at the far right of the taskbar and then click Laptop Battery f NOTE To ensure that you always have battery power when you need it HP recommends purchasing a new battery when the storage capacity indicator turns green yellow Using external AC power Z NOTE For information on connecting to AC power refer to the Quick Setup poster provided in the computer box External AC power is supplied through an approved AC adapter or an optional docking or expansion device A WARNING To reduce potential safety issues use only the AC adapter provided with the computer a replacement AC adapter provided by HP or a compatible AC adapter purchased from HP Connect the computer to external AC power under any of the following conditions A WARNING Do not charge the battery while you are onboard aircraft e When you are charging or calibrating a battery e When you are installing or modifying system software e When writing information toa CD or DVD When you connect the computer to external AC power the following events occur e The battery begins to charge e Ifthe computer is turned on the battery icon in the notification area changes appearance
42. estarted When using Computer Setup you must use the keys on your computer to navigate and make selections 66 Chapter 10 Security Using passwords A password is a group of characters that you choose to secure your computer information Several types of passwords can be set depending on how you want to control access to your information Passwords can be set in the operating system or in Computer Setup that is preinstalled on the computer f NOTE To reduce the risk of being locked out of the computer record each password and store it in a secure place Setting passwords in the operating system Operating system passwords Function Root password Protects access to an operating system root level account User password Protects access to an operating system user account Setting passwords in Computer Setup Computer Setup passwords Function Administrator password e Protects access to Computer Setup e After this password is set it must be entered each time you access Computer Setup CAUTION If you forget your administrator password you cannot access Computer Setup NOTE The administrator password can be used in place of the power on password NOTE Your administrator password is not displayed as it is set entered changed or deleted NOTE If you enter the power on password at the first password check before the Press the ESC key for Startup Menu message is displayed you must enter the admini
43. f static electricity by touching a grounded metal object amp NOTE To use a dual channel configuration when adding a second memory module be sure that both memory modules are identical To add or replace a memory module A CAUTION To prevent information loss or an unresponsive system Shut down the computer before adding or replacing memory modules Do not remove a memory module while the computer is on in the Suspend state or in Hibernation If you are not sure whether the computer is off or in Hibernation turn the computer on by pressing the power button Then shut down the computer through the operating system k 2 3 4 5 Save your work and shut down the computer Disconnect AC power and external devices connected to the computer Remove the battery Remove the access cover screw 1 Slide the release latches in 2 to release the access cover 61 6 Slide the access cover back 3 and then lift it away from the computer 4 7 If you are replacing a memory module remove the existing memory module a Pull away the retention clips 1 on each side of the memory module The memory module tilts up A CAUTION To prevent damage to the memory module hold the memory module by the edges only Do not touch the components on the memory module and do not bend the memory module 62 Chapter9 Memory modules 8 b Grasp the edge of the memory module 2 and gently pull the module out of t
44. g pointing device preferences seessssssesrrrseseernnaainnnnaseennnnannnnnnaaetdnnaaatannaaaeeannnaanan 28 S MUtiMeEdia uuu u y suy sasusshisqsasisskasiakatsspasssspaantasuqsiaassspissyiawkukaasasawapusasnakastaysqu sisustasssiaahinsasqiusaqhss 29 Using the media activity K6y8 Lu aaa asua wpanad asahan ask awaqaaakakasaqkakakaqawqakakabawsskaka 29 Using the audio features UU U U U U U u u 30 Adjusting the VOIUMG laisi EA EE 31 Checking your audio funcions Uu UU aaia AEN AA 32 Using the Webcam select models only U I n 32 Using video dEVICES vie aa e E AEEA 33 VOA eae E E EA EE E E E E E 33 Connecting an HDMI device select models Only a aa 34 Configuring audio for HDMI select models only 35 6 POWER AMA Om eOnl u u 5 5 tennessee name eR ta eT 36 shutting down the COMPUTE u UL deed tecee A EAEE EE 36 Setting power options cece eee ee eee eeeeecaaaaaaeaeeeeeeeeeeeeeeseeeacaacaacaaeceeeeeeeeeeeeeeseeeecceesaeeseeeeeess 37 USING POWEMSAVING states ae 5cscseecvhneceees dane deeed ennn EE EER A EREET 37 Initiating and exiting Suspend oo u ee eeeeeeee tere eeeeeeeeeeeeeeeeeeaaeeeeeteeeaaaees 37 Initiating and exiting Hibernation a 37 Using the POWEN ICOM sssecceiiccecensitvacedeeces edad EEE eet ace E EE ETOO 38 Using power management hisss n
45. g up your information 73 12 Computer Setup Computer Setup or Basic Input Output System BIOS controls communication between all the input and output devices on the system such as disk drives display keyboard mouse and printer Computer Setup includes settings for the types of peripherals installed the startup sequence of the computer and the amount of system and extended memory Z NOTE Use extreme care when making changes in Computer Setup Errors can prevent the computer from operating properly Starting Computer Setup Z NOTE An external keyboard or mouse connected to a USB port can be used with Computer Setup only if USB legacy support is enabled To start Computer Setup follow these steps 1 Turn on or restart the computer and then press esc while the Press the ESC key for Startup Menu message is displayed at the bottom of the screen 2 Press f10 to enter Computer Setup Using Computer Setup Navigating and selecting in Computer Setup To navigate and select in Computer Setup follow these steps 1 Turn on or restart the computer and then press esc while the Press the ESC key for Startup Menu message is displayed at the bottom of the screen e Toselect a menu or a menu item use the tab key and the keyboard arrow keys and then press enter or use a pointing device to click the item e To scroll up and down click the up arrow or the down arrow in the upper right corner of the screen
46. he memory module slot To protect a memory module after removal place it in an electrostatic safe container Insert a new memory module A CAUTION To prevent damage to the memory module hold the memory module by the edges only Do not touch the components on the memory module and do not bend the memory module a Align the notched edge 1 of the memory module with the tab in the memory module slot b With the memory module at a 45 degree angle from the surface of the memory module compartment press the module 2 into the memory module slot until it is seated 63 c Gently press the memory module 3 down applying pressure to both the left and right edges of the memory module until the retention clips snap into place 9 Align the tabs on the access cover with the latches on the computer 1 then slide the cover in to close it 2 The release latches automatically lock the access cover into place 3 64 Chapter9 Memory modules 10 Replace the access cover screw 4 11 Replace the battery 12 Connect AC power and external devices to the computer 13 Turn on the computer 65 10 Security The following sections are included in this chapter Protecting the computer e Using passwords e Using firewall software e Installing an optional security cable Protecting the computer NOTE Security solutions are designed to act as deterrents but they may not deter software
47. heck carry on baggage use X rays instead of magnetism and do not damage drives Replacing or upgrading the hard drive A CAUTION To prevent information loss or an unresponsive system Shut down the computer before removing the hard drive from the hard drive bay Do not remove the hard drive while the computer is on in Suspend or in Hibernation If you are not sure whether the computer is off or in Hibernation turn the computer on by pressing the power button Then shut down the computer through the operating system Removing the hard drive 1 2 3 4 5 6 7 8 Save your work and shut down the computer Disconnect AC power and external devices connected to the computer Remove the battery Remove the access cover screw 1 Slide the access cover release latches in 2 to release the cover Slide the access cover back 3 and then lift it away from the computer 4 Remove the four hard drive screws 1 from the hard drive Pull the hard drive tab to the right 2 to disconnect the hard drive Replacing or upgrading the hard drive 47 9 Lift the hard drive 3 out of the hard drive bay gt l l l l 48 Chapter7 Drives Installing a hard drive 1 Insert the hard drive into the hard drive bay 1 2 Pull the hard drive tab 2 to the left until the hard drive snaps into place 3 Replace the four hard drive screws 3 4 Align the tabs on the access cover with the latches on
48. hut down the computer under any of the following conditions e When you need to replace the battery or access components inside the computer e When you are connecting an external hardware device that does not connect to a USB port e When the computer will be unused and disconnected from external power for an extended period To shut down the computer follow these steps amp NOTE Ifthe computer is in the Suspend state or in Hibernation you must first exit Suspend or Hibernation before shut down is possible 1 Save your work and close all open programs 2 Select Computer gt Shutdown gt Shut Down If the computer is unresponsive and you are unable to use the preceding shut down procedures try the following emergency procedures in the sequence provided e Press and hold the power button for at least 5 seconds e Disconnect the computer from external power and then remove the battery 36 Chapter6 Power management Setting power options Using power saving states The computer has two power saving states enabled at the factory Suspend and Hibernation When Suspend is initiated the power light blinks and the screen clears Your work is saved to memory letting you exit the Suspend state faster than exiting Hibernation If the computer is in the Suspend state for an extended period or if the battery reaches a critical battery level while in the Suspend state the computer initiates Hibernation When Hibernation is initiated yo
49. iaCard Micro e Secure Digital SD Card e Secure Digital SD Card Micro 3 F Audio out headphone jack Connects optional headphones earbuds a headset or G television audio WARNING To reduce the risk of personal injury adjust the volume before putting on headphones earbuds or a headset For additional safety information refer to the Regulatory Safety and Environmental Notices NOTE When a device is connected to the jack the computer speakers are disabled 4 U Audio in microphone jack Connects an optional computer headset microphone stereo array microphone or monaural microphone 8 Chapter 2 Getting to know your computer Component ae USB ports 2 Description Connect optional USB devices 2 RJ 11 modem jack select models only Connects a modem cable 3 Optical drive Reads and writes select models only to an optical disc 4 Optical drive light Lights when optical drive is active 5 Optical drive eject button Ejects the optical drive Right 9 Left COO eel mm Fa S Component Description 1 8 Security cable slot Attaches an optional security cable to the computer NOTE The security cable is designed to act as a deterrent but it may not prevent the computer from being mishandled or stolen 2 a AC adapter light e White The computer is connected to external power and the battery is 90 to 99 charged
50. ianna inan ENAA EEA AE EA AS 38 Viewing the current power management settings 38 Changing the current power management settings 38 Using battery POWER III ua asa au cugaaetececeeeueatcenecceveacucsceevenasldecaceeeseedecnsdesuehecdecevaseaecnieedes 38 Displaying the remaining battery charge 39 Inserting or removing the battery a aaa asss sssasassssaaaaa 40 Charging a battery 1 U U U u u u uu 41 vi Maximizing battery Ilfg_ UUu l ua askhas dadeet dab adagdasasis dladeenv apaqay a das 42 Managing low battery levels U naa 42 Identifying low battery levels uu u u uu 42 Resolving a low battery level a aaa aaaasssasasasaaa 43 Resolving a low battery level when external power is available 43 Resolving a low battery level when a charged battery is available 43 Resolving a low battery level when no power source is available 43 Resolving a low battery level when the computer cannot exit ibernali tu uuu y A ANAA 43 Conserving battery power ciccccccstsesscecccetssececccetessceeeedetesscencentbeseetecerttedsccecerteseceecdebenecenes 43 SlOnngG a Battery k a
51. ic keypad The computer also supports an optional external numeric keypad or an optional external keyboard that includes a numeric keypad Using the embedded numeric keypad Component Description 1 fn key Turns the embedded numeric keypad on and off when pressed in combination with the num Ik key NOTE The embedded numeric keypad will not function while an external keyboard or numeric keypad is connected to the computer 2 Embedded numeric keypad When the keypad is turned on it can be used like an external numeric keypad Each key on the keypad performs the function indicated by the icon in the upper right corner of the key 3 num Ik key Turns the embedded numeric keypad on and off when pressed in combination with the fn key NOTE The keypad function that is active when the computer is turned off is reinstated when the computer is turned back on 24 Chapter 4 Keyboard and pointing devices Turning the embedded numeric keypad on and off Press fn num Ik to turn on the embedded numeric keypad Press fn num Ik again to turn off the keypad amp NOTE The embedded numeric keypad is turned off while an external keyboard or numeric keypad is connected to the computer Switching key functions on the embedded numeric keypad You can temporarily alternate the functions of keys on the embedded numeric keypad between their standard keyboard functions and their keypad functions e To use the numeric function of a
52. ight click the Power icon in the notification area at the far right of the taskbar and then click Preferences 2 Change the settings on the On AC Power tab On Battery Power tab and General tab as needed Using battery power When a charged battery is in the computer and the computer is not plugged into external power the computer runs on battery power When a charged battery is in the computer and the computer is plugged into external AC power the computer runs on AC power If the computer contains a charged battery and is running on external AC power supplied through the AC adapter the computer switches to battery power if the AC adapter is disconnected from the computer 38 Chapter6 Power management f NOTE When you disconnect AC power the display brightness is automatically decreased to save battery life For information on increasing or decreasing display brightness refer to Keyboard and pointing devices on page 22 You can keep a battery in the computer or in storage depending on how you work Keeping the battery in the computer whenever the computer is plugged into AC power charges the battery and also protects your work in case of a power outage However a battery in the computer slowly discharges when the computer is off and unplugged from external power A WARNING To reduce potential safety issues use only the battery provided with the computer a replacement battery provided by HP or a compatible batte
53. in on the card 1 and then remove it from the slot 2 9 Pull the card out of the slot Using Digital Media Slot cards select models only 55 Using ExpressCards select models only An ExpressCard is a high performance PC Card that is inserted into the ExpressCard slot Like standard PC Cards ExpressCards are designed to conform to the standard specifications of the Personal Computer Memory Card International Association PCMCIA NOTE To conserve power stop or remove an ExpressCard when it is not in use Configuring an ExpressCard Install only the software required for the card If you are instructed by the ExpressCard manufacturer to install device drivers e Install only the device drivers for your operating system e Do not install additional software such as card services socket services or enablers that are supplied by the ExpressCard manufacturer 56 Chapter 8 External cards and devices Inserting an ExpressCard A CAUTION To prevent damage to the computer and external media cards do not insert a PC Card into an ExpressCard slot CAUTION To reduce the risk of damage to the connectors Use minimal force when inserting an ExpressCard Do not move or transport the computer when an ExpressCard is in use The ExpressCard slot may contain a protective insert To remove the insert 1 Press in on the insert 1 to unlock it 2 Pull the insert out of the slot 2 To insert a
54. ireless certification 82 WLAN 82 legacy support USB 74 lights AC adapter 10 caps lock 4 drive 8 optical drive 9 power 4 TouchPad 4 Web browser 4 webcam 12 wireless 4 local area network LAN cable required 21 connecting cable 21 low battery level 42 M managing a power on password 68 managing an administrator password 68 Media Card Reader 8 media controls 29 media controls keys 23 memory module inserting 63 removing 62 menu key identifying 6 7 mouse external setting preferences 28 mute key identifying 23 N network cable connecting 21 noise suppression circuitry 21 network connection icons 16 network jack identifying 10 noise suppression circuitry network cable 21 num Ik key identifying 6 7 24 25 num lock external keypad 26 O operating environment 85 operating system 36 operating system passwords set in 67 optical disc inserting 51 removing 51 optical drive 9 60 optical drive eject button 9 optical drive light 9 optional external devices using 60 optional security cable 70 P passwords set in Computer Setup 67 set in operating system 67 pinching TouchPad gesture 28 ports external monitor HDMI 10 34 USB 9 11 58 VGA 33 power button identifying 5 power connector identifying 10 power light 4 power conserving 43 10 33 power on password creating 68 entering 69 managing 68 product name and number computer 82 public WLAN connection 17 R readable media 37
55. ireless devices and the approval markings of some of the countries or regions in which the devices have been approved for use If your computer model includes one or more wireless devices one or more certification labels are included with your computer You may need this information when traveling internationally Wireless certification labels are affixed to the bottom of the computer e SIM subscriber identity module label select models only Provides the ICCID Integrated Circuit Card Identifier of the SIM This label is located inside the battery bay 82 Appendix A Troubleshooting and support B Cleaning your computer Cleaning products Cleaning products Use the following products to safely clean and disinfect your notebook or tablet PC Dimethyl benzyl ammonium chloride 0 3 percent maximum concentration For example germicidal disposable wipes These wipes come in a variety of brand names Alcohol free glass cleaning fluid Water with mild soap solution Dry microfiber cleaning cloth or a chamois static free cloth without oil Static free cloth wipes A CAUTION Avoid the following cleaning products Strong solvents such as alcohol acetone ammonium chloride methylene chloride and hydrocarbons which can permanently damage the surface of the notebook or the tablet PC Fibrous materials such as paper towels which can scratch the notebook or tablet PC Over time dirt particles and cleaning agents can get tr
56. keypad key while the keypad is off press and hold the fn key while pressing the keypad key e To use the standard function of a keypad key while the keypad is on Press and hold the fn key to type in lowercase Press and hold fn shift to type in uppercase Using the integrated numeric keypad Component Description 1 num Ik key Alternates between the navigational and numeric functions on the integrated numeric keypad NOTE The keypad function that is active when the computer is turned off remains on when the computer is turned back on 2 Integrated numeric keypad Can be used like an external numeric keypad Using the keyboard 25 Using an optional external numeric keypad Keys on most external numeric keypads function differently according to whether num lock is on or off Num lock is turned off at the factory For example e When num lock is on most keypad keys type numbers e When num lock is off most keypad keys function like the arrow page up or page down keys When num lock on an external keypad is turned on the num lock light on the computer is turned on When num lock on an external keypad is turned off the num lock light on the computer is turned off To turn num lock on or off on an external keypad as you work A Press the num Ik key on the external keypad not on the computer Using the TouchPad To move the pointer slide one finger across the TouchPad in the direction you want the point
57. lay devices connected to the system For example if a monitor is connected to the computer fn f4 alternates the screen image from computer display to monitor display to simultaneous display on both the computer and the monitor Most external monitors receive video information from the computer using the external VGA video standard The fn f4 hotkey can also alternate images among other devices that are receiving video information from the computer fn f5 Initiates the QuickLock security feature QuickLock protects your information by displaying the operating system Log On window While the Log On window is displayed the computer cannot be accessed until a user password or an administrator password is entered NOTE Before you can use QuickLock you must set a user password or an administrator password fn f6 Displays charge information for all installed batteries The display indicates which batteries are charging and reports the amount of charge remaining in each battery C e fn f7 Mutes or restores speaker sound d fn f8 Decreases speaker volume fn f9 Increases speaker volume t rr fn f10 Plays the previous track of an audio CD or the previous section of a DVD or a BD gt II fn f11 Plays pauses or resumes an audio CD a DVD or a BD P fn f12 Plays the next track of an audio CD or the next section of a DVD or a BD Using the keyboard 23 Using keypads The computer includes either an embedded numeric keypad or an integrated numer
58. le the seller Safety warning notice A WARNING To reduce the possibility of heat related injuries or of overheating the computer do not place the computer directly on your lap or obstruct the computer air vents Use the computer only on a hard flat surface Do not allow another hard surface such as an adjoining optional printer or a soft surface such as pillows or rugs or clothing to block airflow Also do not allow the AC adapter to come into contact with the skin or a soft surface such as pillows or rugs or clothing during operation The computer and the AC adapter comply with the user accessible surface temperature limits defined by the International Standard for Safety of Information Technology Equipment IEC 60950 iv Safety warning notice Table of contents DV omg u 5 a 1 FING IMTOMMALION u uu le ecacedevnsdiavdeteesaduasieiveeadedessbedcncessiabonnedeesbeseiecdssewauanccdeveassceyemeeeudaneess 2 2 Going to KNOW YOUN compie 5 UU i iii iii iwwaswswiwaywsasawawakussyawsaqqwikawaqswaqus 3 MQW oars s ete detec etait eee E E eE A E s Guau A E AE E AE ce 3 TOUCKPAG uu a seenieieds E ei needa ied 3 EQUUS iat ascas teste catee eect ites cc a eee eee cece can au au a E u she faces Ma aaa 4 BURON uuu kuyu nku aa kamata eee scerstsies E E accede E O E 5 KOYS E E E T E E EA 6 EL u A AT EEEE EE N E vey A E tits EE EEO 8 BRightuuu uuu aaa aaa q aaa aaa a a a a a e eaaa aa need I a EE aE 9 Left 6 05 tac sacetntecediedan ys Aal
59. lifting the outer edges of the disc Hold the disc by the edges and avoid touching the flat surfaces NOTE Ifthe tray is not fully accessible tilt the disc carefully as you remove it Close the disc tray and place the disc in a protective case Troubleshooting 79 The computer does not detect the optical drive If your operating system does not detect an installed device the device driver software may be missing or corrupted 1 2 3 4 Remove any discs from the optical drive Click Computer and then click System Monitor On the Hardware tab identify the Storage Controller in the Type column Click the triangle next to the devices until you locate your optical drive If the drive is listed it should be functioning correctly A disc does not play Save your work and close all open programs before playing a CD or a DVD Log off the Internet before playing a CD or a DVD Be sure that you insert the disc properly Be sure that the disc is clean If necessary clean the disc with filtered water and a lint free cloth Wipe from the center of the disc to the outer edge Check the disc for scratches If you find scratches treat the disc with an optical disc repair kit available at many electronics stores Disable Suspend mode before playing the disc Do not initiate Hibernation or Suspend while playing a disc Otherwise you may see a warning message asking if you want to continue If this message is displayed click
60. ll Using firewall software 69 Installing an optional security cable Z NOTE A security cable is designed to act as a deterrent but it may not prevent the computer from being mishandled or stolen NOTE The security cable slot on your computer may look different from the illustration in this section Refer to Getting to know your computer on page 3 for the location of the security cable slot on your computer 1 Loop the security cable around a secured object 2 Insert the key 1 into the cable lock 2 3 Insert the cable lock into the security cable slot on the computer 3 and then lock the cable lock with the key 4 Remove the key and keep it in a safe place 70 Chapter 10 Security 11 Backup and Recovery The following sections are included in this chapter Performing a system recovery e Backing up your information Recovery after a system failure is as good as your most recent backup As you add new software and data files you should continue to back up your system on a regular basis to maintain a reasonably current backup 71 Performing a system recovery Recovery allows you to repair or restore the computer to its original factory state Recovery works from a dedicated recovery partition on the hard drive This type of recovery restores the computer to its factory condition without using recovery discs A CAUTION Using Recovery completely erases hard drive contents and reformats the
61. mputer restarts 68 Chapter10 Security Entering a power on password At the Enter Password prompt type your password and then press enter After 3 unsuccessful attempts to enter the password you must restart the computer and try again Using firewall software Firewalls are designed to prevent unauthorized access to a system or network A firewall can be a software program you install on your computer and or network or it can be a solution made up of both hardware and software There are two types of firewalls to consider e Host based firewalls Software that protects only the computer it is installed on e Network based firewalls Installed between your DSL or cable modem and your home network to protect all the computers on the network When a firewall is installed on a system all data sent to and from the system is monitored and compared with a set of user defined security criteria Any data that does not meet those criteria is blocked Your computer or networking equipment may already have a firewall installed If not firewall software solutions are available amp NOTE Under some circumstances a firewall can block access to Internet games interfere with printer or file sharing on a network or block authorized e mail attachments To temporarily resolve the problem disable the firewall perform the task that you want to perform and then reenable the firewall To permanently resolve the problem reconfigure the firewa
62. n ExpressCard 1 Hold the card label side up with the connectors facing the computer 2 Insert the card into the ExpressCard slot and then press in on the card until it is firmly seated if Using ExpressCards select models only 57 Removing an ExpressCard A CAUTION To reduce the risk of loss of data or an unresponsive system use the following procedure to safely remove the ExpressCard Save your information and close all programs associated with the ExpressCard To remove an ExpressCard 1 Open File Browser by selecting Computer gt Nautilus 2 Click the Eject icon next to the name of the digital card in the Places list on the left pane of File Browser You are prompted that it is safe to remove the hardware device 3 Release and remove the ExpressCard a Gently press in on the ExpressCard 1 to unlock it b Pull the ExpressCard out of the slot 2 Using a USB device Universal Serial Bus USB is a hardware interface that can be used to connect an optional external device such as a USB keyboard mouse drive printer scanner or hub Devices can be connected to the system Some USB devices may require additional support software which is usually included with the device For more information about device specific software refer to the manufacturer s instructions The computer has 4 USB ports which support USB 2 0 devices An optional USB hub provides additional USB ports that can be used with th
63. nded N 55 Using ExpressCards select models only J a a aa aaa saaasasssssssssssaa 56 Configuring an ExpressCard LLL LLL aaa aayqa aaa EEA EEEE 56 inserting an ExpressCard u u asas sasaqa annadida aaa qasa aaa aaaa cbvbnsseeasteevaeeadeces 57 Removing an ExpressCard c efseccegetelesedecueeeecdasaateeesehadscteeecensasceecenabvisceedenebeansedestaenaests 58 Using ga USB GeViCe uusha aq una kashakuna cca daaaane land AAA 58 Connecting a USB device U U U U u u uu 59 Removing a USB device Ju S ua REN AREENA EEEE EEEE ENEE TRAE 59 Using optional external devices uu aasssaassassssasasa q NAE RN EN NANAK RRRA NNE KEENAN N A ERENNERT KARRANKA 60 Using optional external drives J a SARANANE EEKAN EER 60 vii T Memon OQ NS u y m u 2252522 61 10 SeU a u uuu S S S enema nena ee Eee 66 Protecting the computer uu la ARAA kappapuakapaqaylypawashawqhyikkha ya ykan 66 Using paSSW0rdg u u ne pe ciaeeee irai Aane AKEE EEEE sy KEE EAA EEEE ean eee ads 67 Setting passwords in the operating system u 67 Setting passwords in Computer Setup a 67 Managing an administrator password a 68 Entering an administrator password u 68 Managing a power on password a 68 Entering a power on password
64. nloaded file from your hard drive 76 Chapter 12 Computer Setup A Troubleshooting and support The following sections are included in this appendix e Troubleshooting e Contacting customer support Labels Troubleshooting The following sections describe several common issues and solutions The computer is unable to start up Ifthe computer does not turn on when you press the power button the following suggestions may help you determine why the computer does not start up e Ifthe computer is plugged into an AC outlet plug another electrical device into the outlet to be sure that the outlet is providing adequate power NOTE Use only the AC adapter provided with the computer or one approved by HP for this te G 8 ss s 5 5 55 75 e lfthe computer is plugged into an external power source other than an AC outlet plug the computer into an AC outlet using the AC adapter Be sure that the power cord and AC adapter connections are secure The computer screen is blank If the screen is blank but you have not turned off the computer one or more of these settings may be the cause e The computer may be in the Suspend state or in Hibernation To exit Suspend or Hibernation briefly press the power button Suspend and Hibernation are energy saving features that turn off the display Suspend and Hibernation can be initiated by the system while the computer is on but is not in use or when the computer has reached a low bat
65. ou set up and register the computer take the following steps Connect to the Internet Set up your wired or wireless network so that you can connect to the Internet For more information refer to Networking on page 14 Get to know your computer Learn about your computer features Refer to Getting to know your computer on page 3 and Keyboard and pointing devices on page 22 for additional information Find installed software Access a list of the software preinstalled on the computer Select Computer gt More Applications The list of preinstalled software is displayed NOTE For details about using the software included with the computer select Computer gt Help You can also refer to the software manufacturer s instructions which may be provided with the software or on the manufacturer s Web site Update programs and drivers Update your programs and drivers with the latest versions on a regular basis When your computer is registered it will automatically be updated with the latest versions When you register you can choose to receive automatic notifications when updates become available The automatic notifications for operating system updates are available for 90 days You can also go to http www hp com support to download updates from HP Finding information The computer comes with several resources to help you perform various tasks Resources For information about Quick Setup poster e Setting up the computer e Id
66. properly disconnect the external hard drive Before handling a drive discharge static electricity by touching the unpainted metal surface of the drive Do not touch the connector pins on a removable drive or on the computer Handle a drive carefully do not drop a drive or place items on it Before removing or inserting a drive shut down the computer If you are unsure whether the computer is off in Suspend or in Hibernation turn the computer on and then shut it down through the operating system Do not use excessive force when inserting a drive into a drive bay Do not type on the keyboard or move the computer while an optical drive is writing to a disc The write process is sensitive to vibration When the battery is the only source of power be sure that the battery is sufficiently charged before writing to media Avoid exposing a drive to temperature or humidity extremes Avoid exposing a drive to liquids Do not spray the drive with cleaning products Remove media from a drive before removing the drive from the drive bay or traveling with shipping or storing a drive 46 Chapter7 Drives If a drive must be mailed place the drive in a bubble pack mailer or other suitable protective packaging and label the package FRAGILE Avoid exposing a drive to magnetic fields Security devices with magnetic fields include airport walk through devices and security wands Airport conveyer belts and similar security devices that c
67. requently used system functions when pressed in combination with a function key the num Ik key or the esc key 4 Computer key Displays the Computer menu 5 Embedded numeric keypad keys Can be used like the keys on an external numeric keypad when pressed in combination with the fn and num Ik keys 6 Menu key Displays the active program s shortcut menu same as the right click menu 6 Chapter 2 Getting to know your computer Component 1 Function keys Description Execute frequently used system functions when pressed in combination with the fn key 2 num Ik key Enables disables the embedded numeric keypad when pressed in combination with the fn key 3 Integrated numeric keypad When the keypad has been enabled the keys can be used like an external numeric keypad 4 fn key Executes frequently used system functions when pressed in combination with a function key the num Ik key or the esc key 5 Computer key Displays the Computer menu 6 Menu key Displays the active program s shortcut menu same as the right click menu Top Front m 0H Component Description 1 Drive light e White The hard drive or optical drive is being accessed e Amber HP 3D DriveGuard has temporarily parked the hard drive 2 Media Card Reader Supports the following digital card formats e Memory Stick Pro e Memory Stick Duo Pro e MultiMediaCard e MultiMed
68. rophones e Integrated webcam e Preinstalled multimedia software e Mulimedia buttons or keys Using the media activity keys Depending on your computer model you may have the following media activity controls that allow you to play pause fast forward or rewind a media file e Media buttons e Media hotkeys specific keys pressed in combination with the fn key e Media action keys NOTE Refer to Getting to know your computer on page 3 and Keyboard and pointing devices on page 22 for information about your computer s media activity controls Using the media activity keys 29 Using the audio features Your computer enables you to use a variety of audio features Play music Record sound Download music from the Internet Create multimedia presentations Transmit sound and images with instant messaging programs Stream radio programs select models only Create burn audio CDs using the installed optical drive select models only or on an optional external optical drive purchased separately 30 Chapter5 Multimedia Adjusting the volume Depending on your computer model you can adjust the volume using the following e Volume buttons e Volume hotkeys e Volume keys A WARNING To reduce the risk of personal injury adjust the volume before putting on headphones earbuds or a headset For additional safety information refer to the Regulatory Safety and Environmental Notices amp NOTE Volume can
69. ry purchased from HP Computer battery life varies depending on power management settings programs running on the computer display brightness external devices connected to the computer and other factors Displaying the remaining battery charge A Move the pointer over the Power icon in the notification area at the far right of the taskbar Using battery power 39 Inserting or removing the battery A CAUTION Removing a battery that is the sole power source may cause loss of information To prevent loss of information save your work and initiate Hibernation or shut down the computer before removing the battery To insert the battery A Align the tabs on the battery with the notches on the computer insert the battery 1 and then pivot the battery downward 2 into the battery bay The battery release latches automatically lock the battery into place To remove the battery 1 Slide the battery release latches 1 to release the battery 2 Pivot the battery 2 upward and remove it from the computer 3 40 Chapter6 Power management Charging a battery A WARNING Do not charge the computer battery while you are onboard aircraft The battery charges whenever the computer is plugged into external power through an AC adapter or an optional power adapter The battery charges whether the computer is off or in use but it charges faster when the computer is off Charging may take longer if a battery is new h
70. s vary depending on computer model and your location 14 Chapter3 Networking Using an Internet service provider ISP Before you can connect to the Internet you must establish an ISP account Contact a local ISP to purchase Internet service and a modem The ISP can help set up the modem install a network cable to connect your wireless computer to the modem and test the Internet service NOTE Your ISP will give you a user ID and password to access the Internet Record this information and store it in a safe place Using an Internet service provider ISP 15 Identifying wireless and network status icons Icon Name Description alll Wireless connected Indicates that one or more wireless devices are on m Network Connection Indicates that the wired network is connected and active If both connected wired and wireless connections are active the operating system uses the wired connection because it is faster mn Network Connection Indicates that wired and wireless networks are not connected disconnected Creating a wireless connection Your computer may be equipped with one or more of the following wireless devices e Wireless local area network WLAN device e Bluetooth device Turning wireless devices on and off Using the wireless button Use the wireless button to turn both the wireless network controller and the Bluetooth controller off or on simultaneously They can be controlled individually
71. strator password to access Computer Setup Power on password e Protects access to the computer contents e After this password is set it must be entered each time you turn on or restart the computer or exit Hibernation CAUTION If you forget your power on password you cannot turn on or restart the computer or exit Hibernation NOTE The administrator password can be used in place of the power on password NOTE A power on password is not displayed as it is set entered changed or deleted For details about each of these passwords refer to the following topics Using passwords 67 Managing an administrator password To set change or delete this password follow these steps 1 Open Computer Setup by turning on or restarting the computer While the Press the ESC key for Startup Menu message is displayed in the lower left corner of the screen press esc When the Startup Menu is displayed press f10 Use the arrow keys to select Security gt Set Administrator password and then press enter e To set an administrator password type your password in the Enter New Password and Confirm New Password fields and then press enter e Tochange an administrator password type your current password in the Enter Current Password field type a new password in the Enter New Password and Confirm New Password fields and then press enter e Todelete an administrator password type your current password in the Enter
72. t to use the media content Removing an optical disc Tray load There are 2 ways to remove a disc depending on whether the disc tray opens normally or not Using optical drives select models only 51 When the disc tray opens normally 1 Press the release button 1 on the drive bezel to release the disc tray and then gently pull out the tray 2 until it stops 2 Remove the disc 3 from the tray by gently pressing down on the spindle while lifting the outer edges of the disc Hold the disc by the edges and avoid touching the flat surfaces NOTE Ifthe tray is not fully accessible tilt the disc carefully as you remove it 3 Close the disc tray and place the disc in a protective case When the disc tray fails to open 1 Insert the end of a paper clip 1 into the release access in the front bezel of the drive 2 Press in gently on the paper clip until the tray is released and then pull out the tray 2 until it stops 52 Chapter 7 Drives 3 Remove the disc 3 from the tray by gently pressing down on the spindle while lifting the outer edges of the disc Hold the disc by the edges and avoid touching the flat surfaces NOTE Ifthe tray is not fully accessible tilt the disc carefully as you remove it 4 Close the disc tray and place the disc in a protective case Using optical drives select models only 53 8 External cards and devices The following sections are included in this chapter
73. tery level To change these and other power settings right click the Battery icon in the notification area at the far right of the taskbar and then click Preferences e The computer may not be set to display the image on the computer screen To transfer the image to the computer screen press fn f4 On most models when an optional external display such as a monitor is connected to the computer the image can be displayed on the computer screen or the external display or on both devices simultaneously When you press fn f4 Troubleshooting 77 repeatedly the image alternates among the computer display one or more external displays and simultaneous display on all devices Software is functioning abnormally If the software is unresponsive or responds abnormally restart the computer by clicking Computer gt Shutdown gt Restart If you cannot restart the computer using this procedure refer to the next section The computer is on but not responding on page 78 The computer is on but not responding If the computer is turned on but is not responding to software or keyboard commands try the following emergency shutdown procedures in the sequence provided until shutdown occurs A CAUTION Emergency shutdown procedures result in the loss of unsaved information e Press and hold the power button for at least 5 seconds e Disconnect the computer from external power and remove the battery The computer is unusually warm
74. the computer 1 then slide the cover in to close it 2 The release latches automatically lock the access cover into place 3 Replacing or upgrading the hard drive 49 5 Replace the access cover screw 4 Replace the battery Connect AC power and external devices to the computer Turn on the computer m eS p After you install the hard drive you will need to format the drive Follow the on screen instructions to format the hard drive 50 Chapter 7 Drives Using optical drives select models only Identifying the installed optical drive A Select Computer gt More Applications and then select the Audio amp Video group at the left sidebar A list of all the devices installed in your computer including your optical drive is displayed Inserting an optical disc Tray load 1 Turn on the computer 2 Press the release button 1 on the drive bezel to release the disc tray 3 Pull out the tray 2 4 Hold the disc by the edges to avoid touching the flat surfaces and position the disc label side up over the tray spindle NOTE Ifthe tray is not fully accessible tilt the disc carefully to position it over the spindle 5 Gently press the disc 3 down onto the tray spindle until the disc snaps into place 6 Close the disc tray NOTE After you insert a disc a short pause is normal If you have not selected a media player an AutoPlay dialog box opens It prompts you to select how you wan
75. then follow the instructions on the screen 4 Select Yes when you are prompted to confirm your choice of Ignoring Changes and Exiting and the computer will restart Downloading a BIOS update A CAUTION To reduce the risk of damage to the computer or an unsuccessful installation download and install a BIOS update only when the computer is connected to reliable external power using the AC adapter Do not download or install a BIOS update while the computer is running on battery power docked in an optional docking device or connected to an optional power source During the download and installation follow these instructions Do not disconnect power from the computer by unplugging the power cord from the AC outlet Do not shut down the computer or initiate Suspend or Hibernation Do not insert remove connect or disconnect any device cable or cord 1 Open your Web browser go to http www hp com support and select your country or region 2 Click the option for software and driver downloads type your computer model number in the product box and then press enter Click on your specific product from the models listed Click the appropriate operating system a S 2 Go to the BIOS section and download the BIOS software package 6 Follow the installation instructions as provided with the downloaded BIOS software package Z NOTE After a message on the screen reports a successful installation you can delete the dow
76. tifying 5 Web browser light 4 webcam using 32 webcam light identifying 12 webcam identifying 12 wireless antennas identifying wireless button using 16 wireless button identifying 5 wireless certification label 82 wireless devices types 16 wireless encryption 18 wireless icon 16 wireless light 4 16 wireless network WLAN connecting 17 corporate WLAN connection 17 described 16 equipment needed 17 public WLAN connection 17 security 18 WLAN antennas identifying 12 WLAN device 82 WLAN label 82 writable media 37 WWAN antennas identifying 12 Z zooming TouchPad gesture 28 Index 89
77. ur work is saved to a hibernation file on the hard drive and the computer turns off A CAUTION To prevent possible audio and video degradation loss of audio or video playback functionality or loss of information do not initiate Suspend or Hibernation while reading from or writing to a disc or an external media card 339 NOTE You cannot initiate any type of networking connection or perform any computer functions while the computer is in the Suspend state or in Hibernation Initiating and exiting Suspend The system is set at the factory to initiate Suspend after a period of inactivity when running on battery power or on external power Power settings and timeouts can be changed using Power Management in Control Center With the computer on you can initiate Suspend in any of the following ways e Briefly press the power button e Close the display Z NOTE This only works when the computer is running on battery power e Select Computer gt Shutdown gt Suspend e Click the Power icon located on the far right of the taskbar and then click Suspend To exit Suspend A Briefly press the power button When the computer exits Suspend the power light turns on and your work returns to the screen where you stopped working Initiating and exiting Hibernation The system is set at the factory to initiate Hibernation after a period of inactivity when running on battery power or on external power or when the battery rea
78. urn on or off 3 Click Apply and then click OK amp NOTE The computer also supports additional TouchPad features To view and turn on these features select Computer gt Control Center gt TouchPad and then click the Settings button Using the TouchPad 27 Scrolling Scrolling is useful for moving up down or sideways on a page or image To scroll place two fingers slightly apart on the TouchPad and then drag them across the TouchPad in an up down left or right motion Z NOTE Scrolling speed is controlled by finger speed NOTE Two finger scrolling is enabled at the factory Pinching Zooming Pinching allows you to zoom in or out on images or text e Zoom in by placing two fingers together on the TouchPad and then moving them apart e Zoom out by placing two fingers apart on the TouchPad and then moving them together NOTE Pinching zooming is enabled at the factory Setting pointing device preferences To customize settings for pointing devices such as button configuration click speed and pointer options select Computer gt Control Center gt Mouse 28 Chapter 4 Keyboard and pointing devices 5 Multimedia The following sections are included in this chapter e Using the media activity keys e Using the audio features Using the Webcam select models only e Using video devices Your computer may include the following e Integrated speakers e Integrated mic
79. vice is receiving electrical power e Be sure that the device especially if it is older is compatible with the operating system e Be sure that the correct drivers are installed and updated 78 Appendix A Troubleshooting and support The wireless network connection is not working If a wireless network connection is not working as expected follow these suggestions To enable or disable a wireless or wired network device right click the Network Connection icon in the notification area at the far right of the taskbar To enable devices select the check box from the menu option To disable the device clear the check box Be sure that the wireless device is turned on Be sure that the computer wireless antennas are free from obstructions Be sure that the cable or DSL modem and its power cord are properly connected and that the lights are on Be sure that the wireless router or access point is properly connected to its power adapter and to the cable or DSL modem and that the lights are on Disconnect and then reconnect all cables and turn the power off and then back on The optical disc tray does not open for removal of a CD or DVD 1 2 4 Insert the end of a paper clip 1 into the release access in the front bezel of the drive Press in gently on the paper clip until the disc tray is released and then pull out the tray 2 until it stops Remove the disc 3 from the tray by gently pressing down on the spindle while
80. wall jack 2 m w 9 A WARNING To reduce the risk of electric shock fire or damage to the equipment do not plug a modem or telephone cable into the RJ 45 network jack Connecting to a wired network 21 4 Keyboard and pointing devices The following sections are included in this chapter e Using the keyboard e Using the TouchPad Using the keyboard Identifying the hotkeys A hotkey is a combination of the fn key 1 and one of the function keys 2 To use a hotkey A Briefly press the fn key and then briefly press the second key of the hotkey combination 22 Chapter 4 Keyboard and pointing devices Hotkey combination Description iL fn f1 Initiates Suspend which saves your information in system memory The display and other system components turn off and power is conserved To exit Suspend briefly press the power button CAUTION To reduce the risk of information loss save your work before initiating Suspend NOTE Ifa critical battery level occurs while the computer is in the Suspend state the computer initiates Hibernation and the information stored in memory is saved to the hard drive The function of the fn f1 hotkey can be changed For example you can set the fn f1 hotkey to initiate Hibernation instead of Suspend w fn f2 Decreases the screen brightness level ale fn f3 Increases the screen brightness level a fn f4 Switches the screen image among disp
81. wser 5 t 1 Wireless light e White An integrated wireless device such as a I wireless local area network WLAN device and or a Bluetooth device is on e Amber All wireless devices are off 4 Chapter 2 Getting to know your computer Component Description 1 hy Power button e When the computer is off press the button to turn on Sea the computer e When the computer is on press the button briefly to initiate Suspend e When the computer is in the Suspend state press the button briefly to exit Suspend e When the computer is in Hibernation press the button briefly to exit Hibernation If the computer has stopped responding and operating system shutdown procedures are ineffective press and hold the power button for at least 5 seconds to turn off the computer To learn more about your power settings select Computer gt Control Center gt System gt Power Management 2 Web browser button Launches the Firefox browser 3 u i Wireless button Turns the wireless feature on or off but does not establish a I wireless connection Top 5 Keys amp NOTE Refer to the illustration that most closely matches your computer Component Description 1 Function keys Execute frequently used system functions when pressed in combination with the fn key 2 num Ik key Enables disables the embedded numeric keypad when pressed in combination with the fn key 3 fn key Executes f
82. xternal power 2 Exit Hibernation by briefly pressing the power button Conserving battery power e Turn off wireless and local area network LAN connections and exit modem applications when you are not using them e Disconnect unused external devices that are not plugged into an external power source e Stop disable or remove any external media cards that you are not using e Decrease brightness e Initiate Suspend or Hibernation or shut down when you are not using the computer Storing a battery A CAUTION To reduce the risk of damage to a battery do not expose it to high temperatures for extended periods of time If a computer will be unused and unplugged from external power for more than 2 weeks remove the battery and store it separately To prolong the charge of a stored battery place it in a cool dry place Using battery power 43 999 NOTE A stored battery should be checked every 6 months If the capacity is less than 50 percent recharge the battery before returning it to storage Calibrate a battery before using it if it has been stored for one month or more Disposing of a used battery A WARNING To reduce the risk of fire or burns do not disassemble crush or puncture do not short external contacts do not dispose of in fire or water Refer to the Regulatory Safety and Environmental Notices for battery disposal information Replacing the battery Computer battery life vari
83. y alerts and system responses can be changed using Power Management in Control Center Preferences set using Power Management do not affect lights Identifying low battery levels When a battery that is the sole power source for the computer reaches a low or critical battery level the following behavior occurs e If Hibernation is enabled and the computer is on or in Suspend the computer initiates Hibernation e If Hibernation is disabled and the computer is on or in Suspend the computer remains briefly in Suspend and then shuts down and loses any unsaved information 42 Chapter6 Power management Resolving a low battery level Resolving a low battery level when external power is available Connect one of the following devices e AC adapter e Optional docking or expansion device e Optional power adapter purchased as an accessory from HP Resolving a low battery level when a charged battery is available 1 Turn off the computer or initiate Hibernation 2 Replace the discharged battery with a charged battery 3 Turn on the computer Resolving a low battery level when no power source is available e initiate Hibernation e Save your work and shut down the computer Resolving a low battery level when the computer cannot exit Hibernation When the computer lacks sufficient power to exit Hibernation follow these steps 1 Replace the discharged battery with a charged battery or connect the AC adapter to the computer and to e

Download Pdf Manuals

Related Search

Related Contents

User Manual  Descarga de Especificaciones Técnicas  Sony XT-U500V User's Manual  DSP56F802, 56F802  Seagate Barracuda ES Serial ATA Installation guide  Whirlpool GCGM2991TQ0 User's Manual  LP-1030 LP-1030-MF - OKI Data Infotech  Lily Pad Light 1YEAR 1YEAR  B200PBA - Minimizer  Guia do Usuário Termômetro Registrador de  

Copyright © All rights reserved. Failed to retrieve file