Home
USER MANUAL - produktinfo.conrad.com
Contents
1. Display only last SMS C Alternate SMS output fi Interval minutes 5 Number C SMS from File tf SMS from TC35i MV Use word filter Add word Delete nord Save word list Load word list Text a Accept text Fig 69 Figure Editor Menu Signs Text DEnable SMS If this menu point is enabled then a dialog to set the COM port and the baud rate is shown Fig 69 Chose the COM port to which your mobile is connected A baud rate of 19200 should work properly If distortions should be present try a slower baud rate Now click OK to establish the connection to the mobile and if not done already to the provider have your PIN code at hand It is recommended to switch on the 74 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor mobile in advance and to enter the PIN code If done so the request of the software for the PIN can be skipped by entering xxxx It will work also in another way but then the process will last very long and if an error occurs it could happen that you will lock your mobile unintendedly The upper left region of the dialog GSM Status current status information is shown In the lower left window the received messages are displayed The currently per laser displayed message is marked by color in a table Use the mouse to click the respective message it can be selected and edited Within the upper right region of the dialog laser output the
2. Fig 29 The Playlist 35 161 00066470 DOC Version 1 0 EUROLITE HE Main Part The DMX Window is used for the creation and management of DMX macros These serve for the control of DMX devices such as Moving Heads DMX spotlights projectors and other devices which can be controlled by DMX Furthermore the setup of the DMX output hardware is done here File Edit Operating Mode Zuordnung nnnm SPP ereere ce oceecpec CC CC CTLCCECTCCC 1 2 3 4 5 le le l9 jo j1 12 13 14 15 16 j7 js IE 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 33 40 41 42 43 44 45 46 47 48 43 50 Macro Steps Edit Step File DMxX Maste sxs akro p Note Off Figur ALIS No of pe steps ms per intermediate step fo a Reload Reset gt Values from DMX Input i Keyboard Assignment Fig 30 The DMX Window The Live Window has the primary purpose to control a live show by keyboard DMX touchscreen or mouse Furthermore the Live Window is very useful for the key assignment of figures Various other windows will appear according to their context Their functions will be described elsewhere Aie Girin de Adaya Shoe opina Taste pionen Tschoset LiveShow D Uis ep Lip E warn Flath Seach oi ured iki OMIM Armrest
3. gt Buttons to set the direction Here some comments are necessary Example Suppose having already created a macro consisting of multiple steps At step 1 only channel 1 shall be changed at step 2 only channel 2 and so on If now the direction is changed then it can happen that you will not understand the resulting output The reason is that the steps will be put out in reverse order Thus the first step was not put out at all Thus channel 1 was not set to the respective expected value too This should be recognized when using the direction buttons You can avoid surprising results when channels are changed whose change is otherwise not necessary 138 161 00066470 DOC Version 1 0 EUROLITE HE 5 5 1 2 Region Edit Steps gt Buttons Cut Copy Paste With these buttons macro steps can be cut copied and pasted gt Button Create new DMX Macro Push this button to create a new macro 5 5 1 3 Region File gt Buttons Save Save as Save all With these buttons macros can be saved saved with another name or all present macros can be saved via one click gt Button Close Window This button closes the DMX window 5 5 1 4 Additional Elements Output Master Mapper etc gt DMX Interface The DMX interface s are not set within the DMX Editor You can find them at Figure Editor Options DMX Refer to chapter Options for more information gt Scrollbar DMX Master With this scrollbar all DMX channels
4. EUROLITE HE Figure Editor This option enables the software to connect through the incoming DMX data This has two applications 1 If a NetLase DAC is present then the DMX data can simply be sent to it According to the setup also a connection via W LAN is possible 2 The start channel DMX input offset can be used to recalculate high channel numbers into lower ones gt DMX input offset Here the number of the start channel for DMX input can be set That makes sense if for example the first 49 channels are used for other DMX devices Thus the software can be used only with channels above 50 BUT ATTENTION If you set channel 50 as start channel then naturally you can not enter 512 channels in total see above DMX Channels gt Input Interval when Laser Output is stopped running Here the input intervals in ms can be adjusted They define the repetition frequency of the DMX input To prevent a disturbance of the laser output two different values can be set separately For a live show via DMX for both input and output a short interval should be used please test it Pay attention If the USB DAC is heavily used by DMX data transmission then the laser performance will be declined gt Ignore Size Control It is possible to generate a still standing beam via DMX by adjusting the Size Control Channel to small values To prevent this set this option If it is checked all channels which could result in still standing beams are ignor
5. ccsccesseeseeeeeeeeeseneeeeeeeeees 19 4 2 Create Own Figures and ShOWS cccccsccsseceeeeeeeseeeeeneeeeeeeeseneseneseneseneeeeees 20 4 3 Show Folder Save Figures ccssccsscsseccseccneecnecenecenscnescnseoneecnssenssensoneees 23 4 4 Use of Function Keys FO to F12 ce cceecceeeeeeeeeeeeeeeeeeeeeeceeeeneseneseeeeeeees 24 4 5 Assignment of Figures to Keys cccscceeeeeeeeeeeeneeneeeeeceeseneseneseneseneeeeees 25 4 6 Create MuSic SynchronouSs SHOWS ccccccseceseeeeeeeeeeeeeseeeseneseeeseneeeeeeeeees 27 4 7 Load and Use a Live SHOW ccccscceeceeceeeeeeeeeeseeeeeneeneneneeneeneneenesaesaesas 30 4 8 Creation of a Live SIM OW sccectcericpeicwstesatenelccsiesslepeiwusbessiensieecinadieerdunsleeniennieness 32 IMIN FP ANE oera E ce wea NEEE 33 5 1 The Windows of EUROLITE HE ccccscceeeeeeeeeeeeeeeeeeneenseneeneeneeneeeseaes 33 5 2 Figure Editor Main Window ccccceseceeeeseeeeeeeeeeeneeeeseeesceeseneseeesenesenes 38 5 2 1 Creating and Editing Of Figures ccc cccccceccceeeeeeeeeeeeeseeeseeeeseeeseeeeseeeseeeeaes 39 SPAC 9 68 a a g ene eee eee eee 40 5 2 3 Marking and Editing MOONS secede sce csacd psa anaticeceacacecaneneasunaumetde sees aceseehencenesesngnes 46 SS YA oa ME OO aena a ee eee 50 5 2 5 File Buttons Save Save As and Save All c ccccccccceececeeeeeeeseeeseeeeeeeeeeeeeaes 54 TOO VS ON oa AEA E EA EE EEE E E E EA EEE E E 54 I OUOU
6. EUROLITE HE Quick Start A newly created figure is saved to the folder by the buttons Save or Save As If the figure has not been saved before a dialog Fig 16 to enter the name will open Figures already saved will be saved directly overwritten without any warning A new folder to save the figures can be created in the dialog too if you have forgotten to do it in advance see red arrow in Fig 16 On saving the figures no show files will be generated This can be done via the Show Editor when creating a new show you can find more information on this below in the Main Part The button Save as can be used to save an already existing figure perhaps modified a second time with a different file name and to store it at another place The button Save all is used to save all figures which are present in the currently selected show folder The use of this button has the advantage that changes can be done on several figures e g changes done on the effects and then be saved in one step with no need to save each figure individually 4 4 Use of Function Keys F0 to F12 To use figures within a show they have to be assigned to a key EUROLITE HE works internally with pushed keys A key is pushed and EUROLITE HE calls the assigned figure This is also valid if the key is pushed via the Timeline MIDI DMX or something else All keys can be used in combination with the function F keys But you have to
7. Wave 2 r Assignment Wave 7 Assignment 4 ri lio Frequency i 4 bil Frequency E li gt 1000 Period T Vv Y 4 4 gt 1000 Period T B E gt 5000 Amplitude Red mn J gt 5000 Amplitude l Red 4 iio Phase Green 4 ri lo Phase Green Sinus Triangle C Rectangle Backwards Blue Sinus Triangle C Rectangle Backwards Blue Wave 3 7 Assignment Wave 8 Assignment af it ll Frequency rx 4 f h Frequency B 4 4 gt 1000 Period T i p gt 1000 Period T i 4 gt 30000 Amplitude Jv Red 4 5000 Amplitude Red 4 bilo Phase Green 4 i ip Phase Green Sinus Triangle C Rectangle Backwards Blue Sinus Triangle C Rectangle Backwards Blue Wave 4 Assignment f air Frequency rx gt o00 Period T B 4 J gt 3000 Amplitude Red 4 ri lo Phase V Green Sinus Triangle C Rectangle Backwards Blue Wave 5 T Assignment ff gt f fh Frequency i 1000 Period T B m i gt 5000 Amplitude Red 4 ri lo Phase Green Sinus Triangle C Rectangle Backwards Blue Global Settings 4 s0 Number of Frame Points ee 4 gt 20 Frames per Second F cet J Draw x from left to right Draw Y from top to bottom Ethe gt gt Offset x Save Yalues 7 1 Offset Y M Display On Timing ist korrekt ee eg ee j Shutter cleaving the wave NOT visible in preview window Fig 71 Extra Tools Wave Generator The Wave Generator is a very flexible tool to generate wa
8. gt Cut This item has the same function as the button Cut gt Copy This item has the same function as the button Copy gt Paste This item has the same function as the button Paste gt Show Points This function is only accessible via the menu It has to be used to display single points beams in the laser output within the Painting Window You will see all points of the picture in the frame and not only the lines gt Show Blanked Lines This function is only accessible via the menu Use it to make visible blanked points or lines It could be possible that then not blanked points become invisible because a blanked point is lying in front gt View Grid gt 5 or View Grid gt 0 With these options it can be determined if and from which raster value the grid is visible A lock to a chosen grid will always be done This option is useful when you e g zoomed with the magnifying glass and want to move single points 63 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 12 4 Menu Figure Assignment Please also see chapter Assignment of Figures to Keys and the figures 17 and 19 Figure Assignment Frame Tools V Print PC List gt Print PC List ee This item will print out the PC key assignment list only hor nae oP accessible via this menu oe nee Assign all figures automatically gt Show PC List Delete all DMX assignments This item shows the PC key assignment list on your eee iR I
9. gt MIDI Info lenis This button will show some information concerning the remote control of the Playlist via MIDI gt Auto Loop Starts again the first show when the last one was finished The playlist will be repeated endlessly until stopped gt All Shows Automatically starts the next show of the list when the previous show was finished This option is not valid when a show was started by double click 131 161 00066470 DOC Version 1 0 EUROLITE HE show Editor gt Wait before start next show If this option is checked the playback of the next show must be confirmed Advantage If you want to play some shows one after another but you want to tell the audience some things in between then this option helps you The next show is loaded automatically but started only when you confirm via OK gt New List Clears the content of the list to enter a new one gt Load Load a present list via this button gt Save Save the current list via this button gt Create Playlist from Folder Ordner waehlen Alle Shows im Ordner und den Unterondnern in Plavliste Shree et laden E3 SIEMENS als A al Privat J Laser J LaserShows oe Ey E Laserscan Shows Nett Te E ee AAE EEEE EEEE EEE EEEE Oa a Ta ee EE EEEE a a 5 CJ Azubi l Dirk Mueller at_ome_de CJ Blackbird Alex at Laserpics de EJ ChrissOnline CJ Daranus Fig 111 Playlist Create Playlist from folder With this option you can
10. Apply to figure to create an heb frame 83 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 13 5 Push Through Colors Move Colors Through This is a very new tool to io xi create an m ated mu Itifra me J Direction increasing pointnumber figures The animation refers in this case only on color values of single points of the T Al frames of figur figure The color values of the points are just pushed through Within the new multiframe figure the colors will move further from point to point at each frame Thus arene it should be simple to understand that a master figure with 5 colored points Fig 77 Extra Tools Push Through Colors one frame will result in an animated figure consisting of 5 frames Move also blanking To use the tool a drawn and saved figure is needed if not a message is displayed Then the figure must be selected and at least the menu item Push Through Colors at the moment the menu item is named Move colors through has to be clicked After pushing the button Take as Figure the new animated figure will be created The figure now can be stored If you work already on a figure please save it before using the tool else it would be lost The tool offers different options e Direction increasing point number This option determines the direction to push through the colors e Move also blanking When this option is chec
11. Select Figure and set anchor serpentine is given by the number entered 7 6 m p Pply at Count of Pictures me f i RAS w Pfad Plugin 415 Koordinatenpaare Options for compilation lf Use frame from main window is selected then the figure from the Figure Editor will be displayed in the window of the module for the movement on the This is the anchor path ali gt point which will move on the path Source figure or snake line Picture distance If the figure was not already chosen then it cae 1 4 is possible to do it now afterwards The San ee window will perhaps not be updated Pam OMen td automatically In that case click Snake Care oar and then again Use frame from main window Fig 74 Extra Tools Path Tool Selection of Figure and Options The red green colored circle is an anchor It can be moved by clicking the new position This point will move exactly on the created path The option Use color from is playing a role only together with Snake Here you can determine if the color values are taken from the colored path Path or from the window of the Figure Editor Main window The option Fade out will dim blank the end of the serpentine or the last figures when it is set to Yes or dim not when set to No The value set at Picture distance upper scrollbar gives for the case of the serpentine
12. 4 Quick Start This chapter is a quick start guide to help beginners to get first results and to give a first overview of the program There are two options to play laser shows live shows and recorded music synchronous shows The recorded music synchronous shows are also often called Timeline Shows This quick start first explains the Timeline Shows 4 1 Playing a Music Synchronous Laser Show At first you may want to play a prepared laser show to see the performance of your show system Here some basic instructions Shows are generally stored within a folder Each show should have its own folder This folder must contain additionally to the show data figures assignments etc the music file Thus for the first step please copy the desired show into a folder on the hard disk from CD or downloaded from the www that does not matter Now also copy the appropriate music file into the show folder Then start the program and click the menu item File gt Open Lasershow A dialog will open Now the show file can be selected files with ending shw If all necessary files are present and if you have the rights to play the show the show will be loaded and is ready to be played To play the show two modes are ij Show EditorEvents 1 Imin 37sec possible File Edt Tools Settings Play List Infot Countdown e D Play button The laser will be switched on the show is running start at current posi
13. Next you should have a look at the register card Optimize Output Fig 11 Detailed information is given later in this manual At first it is sufficient to do some basic settings 17 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview In this dialog you should at least set the PPS rate PPS means points per second for the respective galvo system which is in use At first it is recommended to set this value to 2 3 of the maximal PPS rate of the Galvo system For example for Widemoves the PPS rate is about 1 000PPS of 25000 All other settings can be neglected for now Optimize Output Reset Settings Hardware Colour Correction Mid DMs Optimize Output 4 wH Extra Colour Foint at Line 5tart Hardware 1 Virtual Device z tpar 4 A H Extra Colour Foint at Line E nd ee E aff H Cone Pon R epeiion J Picture Center after every Frame 800 Hf Mas Distance Laser Off coe a RAI ann Ei H E f a H Frame 5tart Point Aepetition s00 ci H e Distance T H H Frame End Point Repetition 180 wf Mas Point Distance Text 4 a 4 Colour Shift P Pasi Movement if output is OFF dark picture because of safety 3 al i E Colour Shift G Line p 3 af gt Colour Stitt B so i Close Window Export Settings Import Settings Fig 11 Dialog Optimize Output Settings of hardware parameter Experience has shown that the standard settings are not appropriate for the well known 50kpps galvos fro
14. To end the simulation just click the cross in the upper right corner of the window If you click Laser Off or you stop the show the simulation window disappears but it will appear automatically on a restart of the output 10 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 2 EZ AudDAC www laserfreak net forum viewtopic php f 43 amp t 45628 This self made and cheap DA converter which is based on a 7 1 sound card should theoretically work with EUROLITE HE A special DLL was programmed for the audio DAC to use it activate the option Search AudioDAC Options gt Hardware see Fig 3 lower left side The settings must be saved After a restart of the program the AudioDAC driver can be selected 3 5 3 JM Laser dll Devices EasyLase I Il and NetLase www jmlaser com EUROLITE HE supports the JM Laser dll That means generally all DAC by JM Laser can operate with EUROLITE HE But exceptions are known as the rule Because of company political reasons some cards do not work with EUROLITE HE currently the cards EasyLase LC and Ph nix Live Card date spring 2011 possibly they will work sometime For ALL output cards by jmlaser com only one DLL file exists jmlaser dll This DLL is now supported EUROLITE HE If the drivers or the network connections respectively are installed correctly EUROLITE HE detects all cards by jmlaser com in case that it is allowed for the respective card to work w
15. USS Svar ia tele LLLI LLE tit iti titi ts SERRE DOCCRREEERRNE SERRERREEEE a Fig 31 The DMX Window 36 161 00066470 DOC Version 1 0 EUROLITE HE Main Part 37 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 Figure Editor Main Window File 2sckgroundImage Edit Figure Assignment Frame Tools Windows Colour Table Signs Text Test Picture Info Help Figures Always on Top Simulation _ i rom Reset nae Sc v band yc J Dokumente und Einstellunge ianchi 3 ub m LiveShow Information about Figure Fig 32 Figure Editor Main Window of HE Orientation just for information The Main Window of EUROLITE HE is the Figure Editor which serves for the creation and managing of the figures and from which the other windows like Live Window Show Editor Options Effect Window DMX Window etc can be reached The main function of the Figure Editor is of course the creation of figures Possibly the view as shown in Fig 32 will look different on your screen The windows depend on the screen resolution All windows can be changed in size and position On closing the windows their settings are saved and recalled on a later opening Working with three monitors is recommended As shown in Fig 32 the main part of this window is occupied by the Painting Window On the left hand you can find the tools for painting like Frame Tools editin
16. index card Midi DMX see also the chapter 3 5 7 about DMX Hardware and Driver gt Print Width or Height for 1 octave These values are for the printout of the key assignments of the MIDI keyboard This printout refers only onto the assignments of the Timeline It will be printed one page for every 5 octaves of the keyboard with small pictures of the figures For small keyboards the values may be changed to adjust the printout to the keys gt Selected MIDI Port Here a MIDI device can be selected and enabled button Change A plugged keyboard can be used to create a show The modulation wheel Pitch can be used to control the effects gt DMX Channels This is the number of the DMX input and output channels By reducing the number of channels the performance of the program will be enhanced The maximum are 512 channels gt DMX Ports Input and Output Here the respective hardware ports are set up Different hardware can be used for input and output For the input port you can select the destination of the incoming DMX values These values can control the Timeline Show Editor or they can control the Live Window respectively The option Automatically will select automatically the Live Window when it is open or will select the Timeline if the Live Window is closed Pay attention It could be that the Live Window is open but hidden in the background gt DMX through 94 161 00066470 DOC Version 1 0
17. SS Reset fo al a ae Values from DMX Input Fig 125 DMX Intelligent DMX Window For the first impression it looks as if nothing has changed except the five new buttons That is because at first you have to define the DMX devices used refer to Fig 12 for an example 5 5 2 1 Button Edit DMX Device Edit To select or to edit a device this button has to be pushed A new DM Device window will open to enter the data of the device s see Fig 126 on next page Example Fig 126b shows the definition of a RGB moving head The start address was set to 60 within the device Because most elements of the window are self explanatory the following covers only some important things gt Label Here some short descriptions for the channels can be entered 141 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor gt To dim This option is set by setting the respective field to false or true If dimmable true is chosen then these channels can be dimmed via intermediate macro steps If false is chosen the channels will be set instantly to their nominal values This has much influence on the behavior of gobo wheels from moving heads scanners light scanners not galvos and other devices gt Master sensitive This option behaves like the option dimmbar If the option is set to true then these channels can be regulated via the DMX master control Because this function i
18. The speedometer gives information about the actualization of the frames per second But this does not give you information about the rate of the frames which are really put out by the DAC If a delay will occur the DAC will simply repeat the last transmitted frame until a new one is received Deactivation of standby Move mouse or push a key Deactivation of black screen Click with right mouse button into the window Deactivation of black screen and stop the show Click with left mouse button into the window or push the ESC key gt Button Complete Reset The button Complete Reset serves for a actualization of all figures they will be loaded again This could be useful when you have done changes on several figures but are not satisfied with your changes gt Button Assign Figure This button lets you assign a key to the currently selected figure This operation can be activated by a right mouse button click too see also chapter Assignment of Figures to Keys Meanwhile most users use the Live Window for the assignment Thus this button will perhaps be unnecessary in future 5 2 12 Menus of the Figure Editor Nearly all functions and windows are accessible via the menus of the Figure Editor too Fig 51 see also Fig 32 Menu Bar Furthermore you will find additional functions and tools which are accessible only via the Menu Bar e g Wave Generator Path Tool etc File Background Image Edit Figure 4ssignment Frame Too
19. simaken too Midi Mapping ee Wants avait aon gt Use Key Up Event Flash If this option is checked then the figure assigned to the respective key will be displayed only when pushing the key On releasing the key the figure is switched off That works naturally only with the keyboard For DMX or touchscreen flashing is not possible gt Switch off unused tracks If this option is checked then all figures on other than the used tracks by the respective key are switched off Example Key 1 selects a circle on track 0 The track 0 belongs to page A Let s assume track A is assigned to a main projector Key 2 selects for example a wave on track 3 The track 3 belongs to page B Let s assume track B is assigned to a satellite projector Further assumptions For Key 1 the option Switch off unused tracks is chosen but not for key 2 If now key 1 is pushed the circle is displayed on the main projector If key 2 is pushed afterwards then the wave is displayed on the satellite projector while the circle will be displayed If key 1 is pushed again the circle will remain but the wave will be switched off gt Output Tracks 0 11 Here you can select by checking the respective fields on which tracks the figure shall be put out That should be Known already from the Figure Editor Attention If you use show parts then you must define on which track it is running On which tracks the output of the figures
20. 5 False False works with 16 bit resolution SYK Fai Fae s Y Kanal low False False moving heads For not moving devices just enter a 0 ee Fae Fle False False gt Many identical DMX lia Fae Fae devices with different False False False False addresses False False First define one device and DMX Getat verwenden i store the respective data If you have identical devices then you only need to change the start addresses and the device names Then just save the data for the devices using new file names Hence a new device with the same data but with another start address is generated Fig 126b DMX Intelligent DMX Edit DMX Device Example Hint It is not stringently necessary to save new created devices individually You can after the definition immediately push the button Use DMX Device Thereby the device is put into the device list without saving The device list itself will later be stored separately It does not need the single device files Nevertheless it is possibly 142 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor useful to save the single devices If you want to add a similar device later you just have to load it and edit only a few things gt Button Save DMX Device This function is used to save the settings of one DMX device the currently edited one gt Button Load DMX Device With this you can load a ger file and if needed edit it and use it for the de
21. Frames per Second Morph Morph All Change FFS const Frames ta FPS const Frames Fig 60 Figure Editor Menu Frame Tools 65 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt New Frame This menu item is a copy of the function of the button New Frame used with the left mouse button see above gt Delete Frame This menu item is a copy of the function of the button Delete Frame gt Insert Frame This menu item is a copy of the function of the button Insert Frame gt Copy Frames A gt B into Clipboard This function is only accessible via the menu It copies a series of frames into the clipboard The first and the last frame to copy have to be entered into the dialogs which will be opened gt Cut Frames A gt B and Copy into Clipboard This function is only accessible via the menu It lets you cut a series of frames from the current figure and copies them into the clipboard The first and the last frame to copy has to be entered into the dialogs It can be used for deleting a series of frames delete the frames if you do not paste them into another figure gt Change rendering direction of frames in clipboard This function is only accessible via the menu It will exchange the frames of the series within the clipboard so that the first will be afterwards the last The frame series will then be displayed in the other direction than the original gt Paste Fra
22. The Color Gradient is calculated and displayed in real time during the output If the option Optimize Corners is checked it will add additional points to get sharp corners The settings at Options Optimize Output Corner Point Repetitions are applied When your figure is a wave then it is recommended to uncheck this option The scrollbar Perspective is used to change the perspective when viewing the figure Example Paint a horizontal plane above or below the middle and then let it rotate around the x axis Then adjust the scrollbar Perspective to the left The result will be that the plane will be broad in the foreground when it is in the front or small in the background when it is in the back With the box Image Copies it is possible to create copies or mirrored figures The value at Copies X Axis and also at Copies Y Axis describes the number of copies to make If values greater than 1 are set then firstly no copies are visible because they overlap The copies become visible at the time when a displacement or a mirroring is applied At Size 1 1000 it is possible to change the size of the copies With Displacement X Y the displacement of the copies can be adjusted in X and or Y direction The checkboxes Mirror X Y Axis must be activated to mirror the figure on the X and or Y axis The button Reset is used to reset all settings Below Beam Switch it is possible
23. There are sixteen cards for the output Each single route transmits the data stream of the four sequencer pages A B C and D with each 3 figure tracks and their effect subtracks of the Show Editor to that hardware for which it is routed Fig 7 and 8 14 161 00066470 DOC Version 1 0 Hardware Overview im Show EditorEvents 1 12min 43sec 763004 4 ms Fie Showpart Edit Tools Settings Video Play List Info txt Countdown Cut Copy Fey ais Red gt gt b m Fears gt gt Timeline Progress of Song ect Sub l racks for Recordinc 2 Intensity A Compression Y 2 Compression s 2 Rotation 2 SIZE 2 Figure S amp Figure Sub Track for Recording 1 OMe Macrao Fig 7 Show Editor Four pages A B C and D red circle with each 3 figure tracks and their effect subtracks These pages are connected with the hardware output routing for up to sixteen DAC red arrow Hardiware Assignment B C D Hardware 1 virtual Device o al k Hardware 2 Virtual Device C k M Hardware 3 Virtual Device MOTI Hardware 4 No Device a gi fg Hardware 6 Ho Device a gi g Hardware 6 No Device _ Hardware 7 Ho Device E E _ Hardware No Device _ Hardware J No Device Hardware 10 No Device E Hardware 11 No Device go gf ag Hardware 12 No Device __ Hardware 13 Ho Device __ Hardware 14 No Device i Hardware 15 No
24. Vv 2 DMX Macro 2 Rotation 2 Z 2 Rotation 2 Y 2 Rotation 2 x 2 Frame Number 2 Displacement Y O SoSo SSS N 2 Rotation Center Y O SoS SS SSS 2 Rotation Center x 2 Comp Axis Y 2 Comp Axis X 2 Intensity B 2 Intensity G 2 Intensity A 2 Compression Y 2 Compression 2 Rotation 2 Size 2 Figure 1 DM gt lt Macro 1 Rotation 2 Z 1 Rotation 2 Y 1 Rotation 2 1 Frame Number 1 Displacement Y oo O 1 Displacement o O l Botation Center Y ooo A gili lig dda DI 2 A BE TO m m x 1 Comp Axis 1 Comp Axis X 1 Intensity B 1 Intensity G 1 Intensity A 1 Compression Y 1 Compression X 1 Rotation f _ a a e folie Lt I ORotation22 ooo QRotation2 YP O Rotation 0 Frame Number fo 0 Displacement Y ooo 0 Displacement o O 0 Rotation Center Y oo 0 Rotation Center o 0 Comp Axis Y 0 Comp Axis 0 Intensity B OIntensity G O Intensity R 0 Compression Y 0 Compression 0 Rotation ize v 0 Fiqure m Fig 28 The Show Editor 1 The Show Editor comes with a Playlist which is used to play several shows one after another Here you can arrange a list of favorite shows to play Fi b gt Hew Litt fF Lose Fiure sheer Prautinesy Load Pe AN shows Create Playlist from folder 7_9 2 mm m a ae ee ee 5 ham AUTUN NE u NEn n e C m m o m m a m a a a m a a a
25. compatible hardware connected to your PC To be sure you should verify the settings Open the window Options see red arrow in the above picture and select the register card Others First select the desired language by clicking the respective radio button e g English see red arrow in Fig 10 16 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview You can choose between freeware or full version If the USB interface is connected the program runs in full version mode To access the full software package connect the USB interface to your computer before you start the program Then you can use all functions right after program start An additional input of a user name and registration number is not necessary lf you open the dialog Optionen with the interface plugged in you can check Text Show oe EES Optimize Output Reset Settings Output Colour Correction Midi D Ms Hardware Oth iat a Deutsch OW Use francais Show speedometer C Nederlands when screen is Polska Monitor action during playing HO or Playlist shows Undo File black C OBI Jv Save Undo files Italian i show dark screen Style of Colour Select ene engineer gamuacige Spanish W Swich Monitor standby Colour Cube Romana Deaktivate Maus and Keyboard Colour Circle Select Standard Folders Ida Colour Byte order Show E ditor C ProgrammeXSHE_Lasersca Fiqure E ditor C ProgrammeSHE_Laser
26. eurolite TH LASER SOFTWARE USER MANUAL EUROLITE HE Content Content 1 Minimum System Requirements cccccsecseeeeeeeeceeseeseneceeeeeseeeees 4 2 Functional Principle of Laser Show Software and Projector 5 SVS Cel ACL OM seoa E EEP ER EE T 3 1 New Installation a annnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnmnnn T Se UDAI S aE E T 3 3 Hardware OvervVieW cece doe ttieeanceptevespeetwewcanaiwaeuseateneveeteeeecueisianuemtengesseenent 8 3 3 1 Simulation and Virtual DEVICE ce ececc cece eeeeeeeeeeeceeeee cece eeeeeesseeeueeaeeeseeeeeesseeees 9 JoL EZ 00 DY Grn ee a eee ee ee ee eee 11 i Wo Bra icis fe BB o1 gt en oe ee eee ee oe ee eee 11 INO NIN asns E plac EET 11 SNAMI M ea E E S 12 29 0 FIC MIGIV INGIMG eisses a a a a EE 12 3 3 7 MIDI DMX Hardware and Driver cccccccceccceeeeceecceeeeeeeeeeeeeaeeeeeeeeseeseeeeaes 13 1G DN err EAA EEE A E E 13 339 TTE SWINGS oseicorrir innne ene ee 14 3 3 10 MIDI Hardware and Driver cccccccceccceeceeeeeceeeeeeeeeeeeeseeeseeeeseeeseeeeseeesaneeaes 14 3 4 Routing of Hardware Output cccccceseceeeeeeeeeeeeeeeeeeeseneeeeseesenesenesenesenes 14 3 5 Start of the Program can ein snes steps eee 16 3 6 Verifying Of Settings ccc ceeeeee esse eneeeeeenseneeeeseneeesenecneeeesoneeeesensenesneones 16 OT o aes fc E E 19 4 1 Playing a Music Synchronous Laser ShOW
27. make them invisible Furthermore the points of an ellipse should not be moved it could happen that the distances become too large The large distances could destroy the galvos A better option is to use a polygon with about 50 points Or change the optimization method of the dangerous points via the wrench tool gt change properties of points For more information see the description of the wrench tool gt Freehand pi This button will allow for free hand figures Blanked points gt Bezier are automatically generated at start and end Freihand Settings Distance or time value for freehand tool 300 Type of points f Comer points Line Points Uk Circle Points attention no line interpolation Fig 36 Figure Editor Painting Tools Freehand Dialog to set up freehand parameters This tool was developed to allow for the creation of complicated figures e g the painting of figures with the help of background images Its full functionality can be used with a graphics tablet Clicking the right mouse button opens a dialog Fig 36 to make some setups The type of the points to draw corner line or circle points can be selected In the text box above OK the distance or time value for the drawing of the points can be set up These values refer either on distance by painting with pushed left mouse button or on temporal values time lag by painting with pushed right mouse button iN This butt
28. the device name is displayed in bold letters A display of the functions of the respective device appears on the right side of the window 5 5 2 4 Button Save Device List If a device list is completed it must be stored via this button the name is fixed Otherwise the list is lost on a new start of the program The device name is preset by the program internally It is only possible to store a device list this list normally does not change always because it depends on the location Only by storing the device list can be loaded at the next start of the program Loading the device list is not necessary to play shows containing DMX macros The list serves as help for the creation of DMX macros 5 5 2 5 Button Load Device List This button opens a previously stored on this computer device list 5 5 2 6 Button Clear Device List This button deletes the currently loaded device list from the window 5 5 2 7 Use of Intelligent DMX Devices After all above described settings intelligent DMX devices can now be used as intelligent DMX devices The difference should be understandable very quickly The devices and their functions can now be accessed directly In clear text the functions of the present controls are displayed You do not need to think about channel numbers A table function where you could save e g the values for different color wheel positions or Gobos is not available at the time 5 5 2 8 Intelligent DMX and USB
29. which is interfering the big wave See preview window in Fig 1 The period T describes the duration which one point on the wave needs to reach the peak after being in the wave trough The duration is entered in milliseconds In the example in Fig 71 for the wave 1 the duration for one oscillation is 1000ms thus it needs 1 second for the oscillating points to fulfill one complete period to go up and come down again The amplitude describes the intensity of the wave or the color when used In other words It describes the height and the depth of the peak and wave trough The generator internally calculates in relative values in because the amplitudes can be assigned to different point properties Colors are described internally by values from 0 to 255 for each of the ground colors RGB coordinates can have values from 32 67 to 32767 In Fig 1 you can see the big wave with amplitude 20000 and the interfering smaller wave with amplitude 5000 Furthermore you can see the generators 3 and 4 which are assigned to red and green respectively Because they have the frequency 1 and amplitudes of 30000 they generate the white color in combination with blue which is partly dying the wave The phase describes how much degrees the oscillation is shifted in comparison with a wave with phase 0 An example should explain the property of the phase Let us take for the x axis a sinus oscillation and for the y axis too The result will
30. 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Your DAC output rate shall be 25000pps Then only 5 frames per second can be put out The result is a very flickering laser output Even at a DAC output rate of 50kpps only 10 frames per second are possible that is just enough to identify the picture e Take Colors from Background Picture This is the second function of the tool Firstly a figure must be created or loaded Then load the background picture A dialog will open and you will be asked whether to keep blanking or not After closing the dialog the program will look for the colors of the background picture and will take these to dye the figure accordingly With this tool it is possible to make beautiful colored texts for example Another possibility to use the tool is the following Firstly create with Corel Draw an array consisting of lines curves are possible too and export the picture as Al file Then the Al file is loaded and the color is transferred from the points of an bmp file With this method quasi a Raster Scan is created Hint It is advantageous when the background picture has strong and bright colors otherwise the laser output could be too dark Thus it could be necessary to optimize the colors with a graphic program e g Irfanview Shift G In case a dark source picture is necessary the colors can be trimmed to maximal brightness via menu Window Special Functions Normal
31. 112 5 4 Show Editor asusnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnna 113 5 4 1 Buttons and TOOIS cece cece ecceeeceeceeeeeeteeceeeceeeeeeceececeeecaeeaeeteeseeeseeseeeeesees 114 DA Mec WIAA Gla Seinere E OE 114 TENE g o P E A E E ee eee E 114 3 7 04 Foe 5 0 0 A E A E AAE 115 SALA ENOCE TOOL errearen A EENE 115 gA kho BUON IO senna A AE 116 5 4 1 6 Buttons Cut Copy and Paste aanonnonnennennnnnennnrosrerrererrsrrerrsrrerrsrreresrrene 117 S NNE EEE d e a a E E A A E E E A 117 5 4 1 8 Buttons UNdO REO cccececcseeceeeceeeceeteeeseeeseeeteeecseecaeecaeeenetenetseeteeeteeetes 117 341 9 WANS OO COINS serioan TEA 117 5 4 1 10 Further Show Editor El Ment ccccccceccceeecceceeeeeeeeeeceeeeeeeeeeeeeeeeeeeees 119 5 4 2 Menus of the SHOW Editor 0 0 0 ccecccecceeeceeeee cece eeseeeseeeseeeeeeeeeeeseeeseeteeesseeeas 120 SAI VS US aa ET EE EEE E EE 120 942 2 Men SNOW Dai Rete nes ae en ee ee ee en ec eee 127 a ae 1 n E E E ee eee 127 JAAA MENU TOOLS n EE OE 127 5 4 2 5 Menu SettinS ccccsccccsceceseceececseeceeeeceeecoeeeseecageecseeseeeesseesagesseeesseeseeeess 128 5 4 2 6 Menu Video c cece cecceccececeeceeeeeceeceeeeneteceeeceeceeeseesecseeceeseeteeteeeeeeeeeeaeesaees 129 SLF WSU AUS e T E E E T 130 i TMe FIAV Eea a A E E S 130 STU MO E E Ae A E 132 94 210 Menu COURIC OWN rescissione EE NENE 134 9542 11 Menu SNOW DAUM wisasins
32. Blank Mode Y Y Y drive their laser When Gray Scale is selected the e e CR ee intensities will be a little darker over all But there Fimer m r A C Single Beam are differences if the color was originally blue or red With the selection of Brightest Color a blue and a red line will have the same intensity der Farbkonektur ueber LPT Por wid WEDESPIUNGen Oa SANDS gt Button Color Correction This button will open the dialog shown in Fig 88 It Fig 88 Dialog Optimize Outpui button can be used to make a pre setup of the color Color Correction correction Proceed 107 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor You can also find a gimmick which is not accessible anywhere else This tool offers the only possibility within the software to operate lasers in CW mode with full power option Laser CW Mode First you have to select your lasers colors to make a pre setup of the color correction for the selected projector In Fig 88 the colors R G and B are selected checked boxes If you have only red and green lasers then the software will no more control the blue laser and it will distribute the blue color to the other lasers Here analog driven lasers are described TTL lasers will be described later Now the descriptions which are displayed in the lower text box should be read Follow these instructions To compare the brightness of the lasers in CW or modulated Laser Blank Mode modus you can
33. C Mixed beam and graphic DM Setup show Additional infos Delete all entries Define as standard Load Standard Fig 113 Show Editor Dialog Show Info 133 161 00066470 DOC Version 1 0 EUROLITE HE show Editor 5 4 2 10 Menu Countdown gt Start Enter start time OK This menu item is used to start a show by countdown The countdown will be routed depending on the entries at Options index card Hardware Fig 114 Show Editor Menu Countdown Start gt Dialog to enter the time to start the show or to Cancel the If the countdown is used a small Countdown dialog Fig 114 will open to enter the start time Click OK to start the countdown The countdown can be interrupted by switching the laser off Figure Editor Button Laser OFF gt Define Figures This menu item is used to define the countdown figures The figures are inserted via drag and drop They are displayed during the countdown display If these figures shall be displayed only during the countdown you have to remove the check at Options Hardware Countdown Output With the help of these figures it is possible to write Next Show HH MM SS m Spurseite A T Spurseite B rT Spurseite C T Spurseite D Sp ur 1 Count Down Count Down Count Down Count Down Spur 2 Spur 3 Fig 115 Countdown figures Hint The countdown time will be display
34. Dongle Intelligent DMX works only within the full version including USB dongle 144 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor 5 5 2 9 Menus of the DMX Window The menus of the DMX window contain the functions which are directly accessible via the buttons Please look at the description of the respective button for more information 5 6 Control of the Software via DMX and MIDI There are two regions of the software which can be accessed via DMX and or MIDI a The Timeline Window Show Editor tracks b The Live Window 5 6 1 Control via DMX According to the settings at Options gt DMX incoming DMX data is processed via the DMX Input Mapping and then sent to the respective windows at least only the commands are executed which can be done via mouse or keyboard too 5 6 1 1 Timeline Window Show Editor DMX Control For a proper function of DMX control a DMX In port must be selected at the index card Options MIDI DMX Because the DMX input will somewhat reduce the performance of the software the values for the DMX request should be set not faster as needed The more often the program has to request the DMX data the slower the performance of the software will become If you have an output board with DMX input it makes sense to use that for the DMX input Hint In fact it makes currently no more sense to control the Timeline via DMX Currently it makes only sense if you are intended to replace the Tim
35. EUROLITE HE Figure Editor 5 2 2 Graphic Functions Do not forget with EUROLITE HE you will create vector graphics Thus pictures will be drawn from one point to the next For blanked points use the right button of the mouse The tools for painting figures already explained in chapter 4 1 are shown in Fig 25 Thus here is a short list and some additional hints gt New Fig gt Undo gt Redo gt Polyline If the polyline New Fi New Figure To create a new figure push this button J If Undo is clicked then the program will return to the pervious version of the figure The auto saving of undo files could disturb your work greatly e g when big ILDA files are edited Thus the undo function can be switched off via Options Others Undo File M Save Undo files Example Ellipse is selected 4 ellipses will be drawn Then rectangle is selected and 4 rectangles are painted Now assume that the last rectangle was not set to its correct position and Undo is used Then all 4 rectangles will be wiped out not only the last one On a second click Undo the four ellipses will disappear and so on Redo If Redo is clicked then the program will return to the version of the figure as it was before the click Undo Z This button will make it possible to draw connected lines Each mouse click left button in the Painting Window will set a corner poin
36. EUROLITE HE System Requirements 1 Minimum System Requirements e Windows XP Vista or 7 e CPU Pentium 4 1 GHz or better a faster computer enables smoother laser output e 900 MB working memory or better e 5 GB memory on harddrive and memory for the shows possibly less e Sound card e Graphics resolution minimal 1024x768 pixels installed openGL driver Attention netbook users Many netbook displays have less than 768 pixels vertical resolution Thus possibly some operating buttons will not be visible e USB 1 1 or higher for dongle and DAC e Two screens simplify the work with EUROLITE HE The program is made for Windows XP service packs 1 to 3 Windows Vista SP1 and SP2 with 32 or 64 bit and also for Windows 7 Various Mac computers with Windows simulation and even Linux computers are possibly able to work with the program However no guarantee can be given for exotic setups The laser output is calculated in real time Animations may show short stops or will hang up depending on the system load of the computer As a result a system that exceeds the minimum requirements stated above is recommended To run a laser show with four independent projectors and DMX as well as video output via beamer and at least sound you should have an Intel Core Duo with 2 GHz CPU 2 GB RAM a quick harddrive and USB 2 0 A real graphic card is also better compared to an on board graphic card You should certainly think twice about the use of TV card or o
37. Each track has a certain function 19 subtracks belong to a laser track Thus a laser track is able to manage a figure and all respective effects In total there are 4 track pages A to D with 3 laser tracks on each page Hence 12 figures can be called simultaneously including their effects The principle function of the Show Editor keyword sequencer is the following The Show Editor starts the selected audio file wav or mp3 file by clicking the buttons Play or Record During the music playback the program always evaluates the current song position and works with that value progress bar in Timeline If new parts are recorded then according to the position new commands for effects or figures are inserted into the active Subtrack Furthermore during the show playback or recording the events of the tracks are sent to the respective windows 2 161 00066470 DOC Version 1 0 EUROLITE HE show Editor In reality it is not the respective window which receives the commands but for the user it seems to be like this Changes of the figures will be sent to the Figure Editor effects will be sent to the Effects Window DMX events will be sent to the DMX Window The activated windows then seem to calculate and perform the necessary output procedures Within the Timeline the progress already played time of the show is shown Furthermore on using wav files for the music the loudness of the music is disp
38. Editing Tools New or already existing figures can be edited For this Marked Region purpose you can use the marking and editing tools Cut Fig 38 The tools are Hand The hand is the most important tool of this group of objects With this tool points of a figure are marked To mark points click the hand button with the left mouse button and pull a marking Square around the desired region Fig 39 Fig 38 Figure Editor Tools to mark and edit File Background Image Edit Figure Assignment Frame Tools Windows Colour Table Signs Text Test Picture Info Help Figures Always on Top Output Path lA 0 ame Tools 46 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor File Background Image Edit Figure Assignment Frame Tools Windows Colour Table Signs Text Test Picture Info Help Figures Always on Top Output Path v Fig 39 Figure Editor Tool Hand On the left side a marked region is shown marked by use of pushed left mouse button The marked points are indicated by colored circles around them and the hand tool has a red background to indicate that a region is marked blue arrow Sometimes it might be necessary to set the grid to 1 to reach points which otherwise lie beneath the grid If the background of the hand button is red colored blue arrow in Fig 39 it is an indication for points marked already In the Painting Window the marked points will be surrounded by colored circ
39. Firstly select a suitable figure and project it on the wall Recommended figures are saved in the folder HE_TestBilder and named TestBild1 heb or FarbBlanking_Kreis heb If you now change the values you can see immediately the resulting output A suitable figure could also be a combination of a circle and a square together with a multi colored line and some single points beams Additionally a few letters can help This figure eventually will flicker but it is more important to look for clean ends of lines and for sharp transitions of the colors You should try to remove long finishings of line ends Finally you should try to get sharp corners of the square but they should not be displayed with much more brightness than the planes It is not possible to give a universally description to do the settings thus you have to experiment with the values Good luck at the experiments 103 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 3 6 Index Card Hardware The hardware is already explained in the chapter 3 5 Hardware Overview Please go there for more information Additional hint The option Countdown Output determines on which output pages the countdown will be put out 5 3 Index Card Output Show Others Optimize Output Reset Settings Colour Correction Midi DMs Hardware Output Options global Mirror Hardware 1 Virtual Device Qutput H ardware D Miro l Boo Copy geometmsett
40. Pangolin color table Menu gt Color table and then convert to HE colors Menu Windows gt Special functions gt button Change colors to HE colortable values gt Save ILDA This menu item serves to export a figure as ILDA file Important On this export only the basic coordinates will be exported An optimization or interpolation will not be done If you want this and when you want to export a complete show too then please use the respective export function of the Show Editor menu File Export Show as ILDA file Different ILDA formats are offered The best is a type 5 ILDA file RGB But attention Not all programs can read all ILDA formats correctly In the emergency case you have to accept the simplest format This means that only the point coordinates of the figure without RGB values or color table are exported Nearly any program can read this format EUROLITE HE offers no recalculation of the color values to the Pangolin color table Thus programs based on the Pangolin color table will display wrong colors gt Import Al file Adobe Illustrator This menu item opens a dialog to import an Adobe Illustrator file format 5 This import may or may not work Tip The inexpensive Corel Draw can create Al files in the respective format Some additional tools are also available some are free some are very cheap to export convert ILDA files from animation software These then can be used with EUROLITE HE gt E
41. PlayHQ Record Back Stop mea umber n Ert f2 hotation Lerte Pages A D 3 conti is r arr re F Key 2 Intensi Fi Timeline Lit TL Lm LI 2 Compression ss obatior e z o a pmi 7 A Events 1C in Intensity B U U OD 1 Intensity A C 1 Compression S OOOO O q Compression ts Potation N ize ES S igure Er s S V nf S S e ee eae 0 OM Macro ener Og 0 Rotation 2 e ee 0 Rotation a 0 Rotation 2 I O Frame Mumber DD Fa me f all Dizplacement Displacement Riotation Center alion Center E 19 Sub Tracks ooo D a Vv pd a rac I Intensity B Soc oS o aad im lin 5 E a k aes SD aa E h Compression t Compression E mm ae I l Ize Figure l Fig 92 The Show Editor The Show Editor Fig 92 is used to create music synchronous laser shows or to play them respectively Very simple spoken It is like a multitrack cassette recorder or like a MIDI sequencer software on each track events can be recorded You have to select a track for the recording choose the start position and push the record button When listening to the music and seeing the already recorded parts of the show new elements or events are simply added simultaneously by pushing the assigned keys Events can be Calling of figures changes of effects DMX macro callings etc
42. a copy of the function of the button Morph All gt Change PPS const frames to FPS const frames For your information This tool does not work not optimally yet and is included only for test purposes History of this function Some programs export ILDA files with constant PPS rate Thus if you send each single point of the file with a certain delay to your galvo then the show should theoretically be synchronous to the music Other programs the most including EUROLITE HE export ILDA files with constant FPS rate frames per second see hint at description of the respective frame tool then you understand the difference This tool should change the frame series so that a PPS constant file can be converted to a FPS constant file Until now the functionality could not be tested fully because of missing files But meanwhile all programs have changed the export to FPS constant ILDA files 5 2 12 6 Menu Windows gt Options Windows Colour Table Signs Text Test Picture Info Help This menu item and the submenus Text ial Furicti h see Fig 61 IS a copy of the function Special Functions Shan P 7 DMs Midi DM of the button Options see chapter Show Editor Others Options and Hardware Overview oa a PAA With its help you can access the Joystik wiimote controller Display Correction res pective reg ister card of the Beat Counter Colour Correction window Options directly The reset Pe EREE E ee of the windows po
43. a number without unit is entered then it means frames per second fos For example if you enter 20 then 20 fps will be displayed e Frame rate with unit ms If a number with unit ms is entered then every frame will be displayed for the entered duration of milliseconds For example if you enter 20ms then every frame will be displayed for 20 milliseconds or in other words you will have a frame rate of 50 fps e Frame rate with unit bpm lf a number with unit bpm is entered then it means that all frames will be displayed xx times per minute a For example if you enter 20bpm then the frame rate will be adjusted by the program in that way that the series of frames the figure will be displayed 20 times per minute This unit is for laser shows which shall fit perfectly to the timing of the song very useful If your song has e g 64bpm and you enter this value for your figure it will always be in beat with the song The bpm of a song can be determined via the tool Beat Counter which is available in the Show Editor menu Tools Hint only for information In the following a technical information about PPS picture repetition rate and FPS If a figure consists of multiple frames then you can determine the speed of its display by Frames per Second Here you have to remember the following If we assume that every frame shows a picture consisting of 500 points an
44. and Virtual Device For the simulation no additional hardware is necessary however only those projectors will be simulated which are assigned in the register card Options Hardware Thus when a first installation of the software is done at least one Virtual Device is selected as hardware If the software detects any DAC like EasyLase or similar ones these will be put into the list in the order as they are detected This proposal can be changed by the user at any time Regardless which cards are now assigned to start the simulation just click the button Simulation see Fig 9 If only Virtual Devices are existent the simulation window is opened automatically by clicking Laser ON The simulation also works with real hardware It is not possible to run a real laser output and the simulation at the same time w Simulation Punktzahl 19238 7 Ioj x Options Options Size Shows Open GL transparency a V Beam J Graphic T gt Fog projector 1 projector 5 C projector9 projector 13 C OpenGL q Silene projector 2 projector 6 C projector 10 projector 14 C DirectX _ projector 3 projector 7 C projector11 projector 15 4 gt Beam projector 4 projector 8 projector12 projector 16 Reset gt Screen Move an Fig 4 Simulation of figures and laser shows Use right mouse button to open the setup dialog above Up to sixteen simulated projector
45. assignments are used for the keys etc To load a prepared live show you can use the menu File Load Live Show Another way to load a live show is the following Open the Live Window and push the button Load Live Show Once a show has been loaded this can be accessed again quickly via the menu File List of already loaded shows As for a music synchronous show all files for the live show have to be stored within one folder The file extension of a live show is live After successful loading you will see a window on your screen as shown in figure 24 o Fie Controller Assigne Show optio Taste 1 Option iai xi R otation Com fessionX v Ro tation 2 gt ir ntensity RGB enos echo J Use kK on Even T utput Track 0 T Swich off u utput Track 1 IV Ou ro A l DMX Assignemen va DMX Start Value x Output Tra ue Automatic Mode W e a ua Te ack 3 B i a Po E R indow on to DMX Stop Value Output Track 5 Sat 7 g r ali E Tht ebb dell Pan Fig 24 Live Window after loading a live show 30 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start You will see something like a keyboard with figures on the keys In the upper region the options of the whole show and the options for the currently selected key are shown In the upper right region five controllers for effects are placed If your screen resolution is not sufficient it could result in some hidden cont
46. behavior is necessary Optionen Text Ausgabe Sonstige Ausgabe Optimierung Midi DMX Hardware Optionen Farbkorrektur A be Hard Projektor Helligkeit ae ay WE Publikums Bereich Globale Helligke Min a Min P Min bine a re 4 j E Farbkorrektur zL an oS f Reset Farbkorrektur al al aj Zeige geblankte Linien Intensit t Hellste Farbe Intensit t Graustufen a JH di dd di 0 0 0 0 ion Boe Boat Fig 102 Settings of the Color Correction for ILD show export 124 161 O00066470 DOC Version 1 0 EUROLITE HE show Editor Output Optimization Important No Color Shift Just copy the other values The PPS rate does not matter for the export Optionen Text Show Midi D Ms Drucker Sonstige Ausgabe Optimierung gt Hardware Ausgabe Farbkorrektur r Ausgabe Optimierung Ei Extra Farbpunkt Linienstart 30000 al i PPS 1 Ausgabe Hardware eC 3 aji E l Extra Farbpunkt Linienende W Bildmitte nach jedem Frame E all l Eckpunkt Wiederholung e all l Framestart Punktwiederholung a00 aj l Max Strecke Laser AUS 2o aj W l Frameende Punktwiederholung a i U ota 2 atl a l Wiederholung von 1 und letztem hellen Punkt af l Abstand fur Softcolor al Max Punktabstand Text a ae EEE i S cannebewegung wenn keine Ausgabe stattfindet wegen Safety l Farbverschiebung A fe Punkt T i l Farbverschiebung G t Linie Eo l Farbyerschiebung B Kreis Fig 103 Settings
47. computer screen The old list is replaced by the Live Show Unused Keys Window because there a better overview is given Fig 58 Menu Figure Assignment gt Print Keyboard List This item will print out the MIDI Keyboard assignment list assigned keys of the MIDI keyboard This function is only accessible via the menu The printout can be cut and glued onto the keyboard gt Show Keyboard List This item shows the MIDI keyboard assignment list on your computer screen only accessible via this menu gt Assign Figure This menu item is a copy of the function of the button Assign Figure which is offered via a right mouse button click of the Figure Table too For more information see chapter 4 3 gt Assign all Figures automatically If you use this menu item all existing assignments are canceled and the currently loaded figures are assigned automatically to keys This is done with increasing F key number when many figures are present but not with a special sorting A message with the question if also MIDI and DMX shall be assigned is displayed gt Delete all DMX Assignments This menu item will delete all present DMX assignments gt Delete all MIDI Assignments This menu item will delete all present MIDI assignments gt Delete all key assignments This menu item serves to delete all key assignments gt Show Unused Keys This menu item gives you an overview about the free keys which have not been assigned yet
48. display method for the messages morphed or scrolling text can be selected In the lower right window forbidden words can be entered to a list These words will be substituted by XXX The list can be saved and loaded In the center of the dialog button Read all SMS from mobile you can set up logging and answer functions Important SMS from File or SMS from TC53i In general the SMS should come from the TC35i Furthermore there are some programs available to convert SMS to txt files e g http www t2slive co uk These txt files then can be imported into the program and handled like original TC35i messages Each SMS text is always fully projected before the next SMS is displayed You alternate between SMS messages If the interval for display is set to 0 1 minutes then each SMS which lasts longer than 6 seconds is displayed once and afterwards the next SMS is shown 5 2 12 9 Menu Test Pictures and Fix Figures Via this menu a table with different test pictures some from the DAC EasyLase is accessible Additionally the figures are shown which are stored in the FixFiguren folder The test pictures are stored in the TestBilder folder as bin and heb files The figures stored in FixFiguren shall help you to adapt effects with beams reflected by mirrors In general your mirrors will have different places than those of the original show With FixFiguren your own positions will be recognized
49. given Galvo system So the tool serves to change the properties of the points Three optimization methods and their combinations are selectable Available are optimization methods of corner points of colors and of distances respectively Please remember that some optimization methods may perhaps destroy your galvo system They are marked with a red background color The methods with green and yellowish background should be harmless for your galvo system dependant on the PPS rate gt Fa Pipette take color This tool is used to take the color of other parts of a figure First mark the desired points then click the tool Or click the tool and then click the place of the figure with the desired color Now you can recolor other parts of the figure with the same color gt QJ Magnifying Glass This tool is used to magnify regions of the painting window It allows to manipulate points at the level of pixels In this context a hint on the settings within the menu Edit View Grid 0 or gt 5 According to the settings it is really possible to move points at the level of pixels Meanwhile there are several ways to use the magnifying glass A Select the magnifying glass and mark a region with pushed left mouse button The marked region is displayed magnified In doing so the marked region is stretched to fit into the painting window Thus possibly distortions may occur B Select the magnifying glass and move the mouse curs
50. heb for the laser output Now your projector should display some planes which show a color gradient from white to black Open the color correction index card and adjust the fine tuning of the colors The aim is to get white gray lines Starts and ends of the lines should show no color fringes The following procedure is recommended 109 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 1 Scrollbars Green Max and Blue Max set to minimum only the red laser is on 2 Increasing of Red Min until the dark region where the two outfaded lines hit is just black 3 Now Green Max to maximum Red Max to minimum Increase Green Min until the dark region is just black 4 The same for blue 5 Now the Min Values are set properly 6 Now increase all Max scrollbars to maximal values Then decrease the colors which are to bright to get a clean white 7 Theoretically you should get now lines which are at least white at the start and end In the middle half brightness the lines can still have a little depth of color These can be tuned to white using the middle scrollbars non linearities The aim is to get only white gray lines But very likely only a compromise will be possible In order to always get a clean white or gray will perhaps only be possible with very expensive and highest quality DPSS lasers Another suitable figure for the color correction is Farbverlauftest_2 heb A further very good possibility offe
51. is a difference Use Soft Color is created just at the output of the figure But when you intend e g to push through the colors of a figure with color gradient or to use a color gradient for the path tool then Use Soft Color is useless Thus for these purposes color gradients can be directly calculated via this tool to insert them into the figure gt Live Window Menu item to open the Live Window 5 2 12 7 Menu Color Table The menu item Color Table is used to manipulate the Color Table Colour Table Signs Text Test Pi Save gt Reset load Reset will reset the Color Table to default HE colors Load Pangolin Colour Table gt Save Fig 66 Figure Editor Menu Color Table Save is used to save the Color Table For example if you have imported an ILDA Color Table you can save this via this menu Each show can use its own Color Table This will be saved automatically on saving the show Overall it should not be necessary to use this function anymore Formerly it made sense when ILDA files including a color table were on the market gt Load With Load you can load a previously saved Color Table gt Load Pangolin Color Table Via this menu item the Color Table from Pangolin can be loaded These tables were often used for ILDA files You can load an ILDA file load the Pangolin Color Table and finally export again as ILDA file From that moment the HE Color Table is used if a
52. it select the file type wav Ses eae or mp3 in the dialog All show files and figures must Show Dongle Protection be stored in the same folder E Tschosef _LiveShowg live After the selection of the song the Figure Editor opens Runaway shw the show folder automatically Now the creation of the Fig 99 Show Editor Menu File show can start It is recommended to use prior the function Save as to enter the name of the show file If you want to program the show by using a wav file but later want to use a mp3 file of the same music title then put both music files into the show folder After finishing programming just delete the wav file On a new loading of the show the 120 161 00066470 DOC Version 1 0 EUROLITE HE show Editor program will give a message that the music file is missing Then go to Options Index card Show and select there the mp3 file gt New Show Part This is a new special function introduced with version 4 of the software Now it is possible to create parts of a show and save them within the show folder These show parts appear in the Figure Table can be assigned to a key and used within a live show or in a laser show respectively There are some limits to remember e A show part shall not contain callings of other show parts e If several show parts are running at the same time the last called event has priority Eventually it can come to chaos if one show parts terminates anothe
53. item is used to save the show with another name or to give it a name It is possible to use the same show folder for different shows if they all use only figures which are present They can use different song files too gt Clear Timeline Via this menu item the complete content of the tracks is deleted gt Export Show as ILDA file Via this function the whole show can be exported as ILDA file The sense of it is the easy sharing of shows with other show software if allowed Via the ILDA export and subsequent import the shows can be prepared as one track shows too some points have to be recognized e The show will be exported including the optimization color correction and geometrical corrections For the export as ILDA file all options should be reset or set to maximal values e g output size Hint For this operation the import export of ini files within the Options dialog is very useful Here you can set up an ini file only for the ILDA export e f more than one projector is used then for each projector an ILDA file will be generated recognizable by the added number at the ILDA file name e The ILDA file contains 2 dimensional coordinates e The ILDA file can contain a color table e The ILDA file should be created as RGB file The software does not create ILDA files with Pangolin colors e f the ILDA file is exported without color table and without RGB data then later the colors will presumably not be shown as in the origina
54. repeatedly or simply skipped The options Line in using increasing decreasing point number are used to develop arise the figure Increasing or decreasing gives the direction of the process The options Line out using increasing decreasing point number are used to let disappear the figure Increasing or decreasing determines the direction of the process 82 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 13 4 Bitmap Trace Tool This tool serves for an automatic conversion of simple logos or line drawings to frames for the laser output The tool tries to extract the borders of the picture and convert them to vectors Thus it is often the case that complicated pictures will give too many points for a proper laser display Then try to reduce the number of points by varying the scrollbars below Options e g less resolution Load Picture and longer interpolation j Resolution distances matto Corner sharpness First load a picture via the BE E button Load Picture Then liepa a f feo push the button Trace Image fom z to start the sampling During the Sm sampling the program tries to Fig 76 Extra Tools Bitmap Trace find out the borders of the picture and converts the course into a vector graphics The progress of the sampling is indicated via a bar In the header of the dialog the number of points of the resulting
55. shows the functions for an RGB moving head the color selection box and the XY joystick field For the XY joystick the possibility to use a grid 143 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor Raster is given The grid works a little different than that of the Figure Editor Value 4 divides the field into 4 equal parts etc This can be advantageous for the use of moving heads especially if they can rotate more than one times around the x axis Attention If several devices are selected simultaneously for editing there may be problems on the display of the current values The values of the last selected device are always shown If the values of the respective channels of the current macro for the other devices are different then this has perhaps been overlooked It will be very problematic if several different devices are selected simultaneously Then there may be confusing displays especially when the different XY and RGB assignments shall be shown onto the scrollbars because the respective channels have been labeled within the device editor Thus the labeling should be disclaimed and then the channels are not shown at all It is possible to select several head moving floodlights and to modify their X and Y position also when their channel numbers for Pan and Tilt X and Y are different 5 5 2 3 Selection of the DMX Devices to Create Macros On pushing onto a device within the list it will be marked as ACTIVE
56. start is to come to the start of the show and the blue square is used to stop the playback or recording The start position for playing or recording can be determined by clicking the desired position in the tracks or in the Timeline If the playing or recording is stopped afterwards and restarted again then it will be restarted at this position until another position is selected or the violet arrow is clicked The start position will be changed when events are marked or deleted Furthermore a region for loops can be defined gt Button Play gt This button should only be used for the editing of a show This button starts the replay of the show but the quality could be less than by the use of the 117 161 00066470 DOC Version 1 0 EUROLITE HE show Editor Play HQ button According to the setup in the Show Editor menu Settings Start Stop Laser output automatically the laser will be switched on automatically or not The same is valid for the DMX output If the playback begins in the middle of the show and a figure is called by this whose calling should rather be earlier and which is changing due to effects then it may happen that the course of the effect is not displayed properly gt Button Play HQ gt This button was already explained above The show will be played in high Ha Quality modus with black screen gt Button Record This button starts the recording of the events on the marked subtrack According
57. the projection is positioned above the heads of the audience If that is not the case please adjust the height via displacement Y You can use for this setup the figure Sicherheits_MittelLinie Ueber _Kopf heb Now the show size can be adjusted with the square in 100 effect size If it is set below 100 then the remaining X gives the regions for effect displacements Hint to no 6 Setting up the center line above the audience was established because show programers expect this The dangerous beams are set always above the center line by careful programers Thus if this setting is done incorrectly dangerous beams could hit the audience Remember These settings should be done before the audience sits down The security should always be guaranteed People who are in the room when these settings are made must be informed and the danger should be explained Generally the safety of every show should be tested in advance of a presentation 106 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 3 8 Index Card Color Correction Text Show Others Optimize Output Reset Settings Output Colour Correction Midi D Ms Hardware r Colour Correction Options r Projector Brightness Audience one Hardware 1 Virtual Device OutputHardware Global Brightnes Green Copy colorsethings to Red Min Max Min Max Colour Corection er Jj Reset Colour Corection T S
58. the speed of the laser output because all calculations which are necessary for the display on the screen actualization of the effects figures etc are then no more necessary The light of the screen will not disturb the laser show too 57 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Depending on the kind of the graphic card of the computer the increase of the speed can be very impressive Meanwhile via Options Others it can be selected additionally whether only a black screen is displayed or if the monitor is set to standby Advantage of standby This mode works also with several monitors The rest light will be suppressed totally Disadvantage The start of the show will be delayed a little bit eventually the delay of the show start must be adjusted for PlayHQ Another disadvantage Every use of the mouse or every push on a key will finish the standby of the monitor This can cause some bucking of the show Thus Keep your hands off the mouse or the keys One more disadvantage Video beamers which are connected will get no more signal and thus will eventually switch to their blue picture with the information No Signal but else only advantages lf a show is started via PlayHQ or via countdown timer or via Start xx Seconds function then the button Black Screen will be activated automatically When the monitor is black a speedometer can be activated and displayed dialog Options Others
59. to the last new frame Right mouse button A click with the right mouse button on the button New Frame will also add a new empty frame at the end of the current frame series Additionally all points of the current frame are copied to the new frame gt Delete Frame This button will delete the currently selected frame The previous frame will now be displayed If you want to delete frames 3 to 8 for example the firstly select frame number 3 the number of the currently selected frame is displayed in the lower left corner of the Figure Editor see Fig 32 and then click six times on Delete Frame Alternatively the use of the menu Frame Tools in the menu bar is possible Cut Frames A gt B into Clipboard gt Insert Frame This button will add a new frame on the current position it will then be in front of the previously selected one All following frames will be shifted backwards This tool can be used with the right mouse button too Via the right mouse button the content of the frame in front of the currently selected frame is inserted into the new frame gt Morph With the Morph button it is possible to achieve a smooth change from one picture frame to another But the range of possibilities is limited The function will work correctly for color changes only with the original Color Table 90 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor The internal operations of the program are the foll
60. to activate the 8 TTL pins of the DAC EasyLase or Lumax These beam switches are connected with a figure even a non existent one If the beam switches shall be used then the connected figures must be placed into the lowest subtrack of the Show Editor figure subtrack 0 Otherwise they will simply be ignored With the help of the options in the box Shadow it is possible to suppress the output shadow at the top Top the bottom Bottom the left Left or and the right Right side of the figure The shadowing refers to the geometrical center of the painting window If the output of the scan area is shifted via Options Output it has no influence on this effect 89 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Bur Show Others Optimize Output Reset Settings Output Colour Correction Midi D Me Hardware Optimize Output 4 H H Extra Colour Point at Line S tart Hardware 1 Virtual Device E pa eae 4 HA H Extra Colour Point at Line E rnd Copy optimicesettings to E aA Caner Pan Rescue J Picture Center after every Frame ag Hf H Mas Distance Laser OF oe 7 n ie an0 A gt Weep areelececae T Hf H Frame Start Foint Aepetition s00 A Saft Colour Distance T Hf H Frame End Point Repetition 180 l Mas Point Distance Text 4 af f gt Colour Shitt F Pasi ovement if output is Ott dark picture because of safety 3 at H Colour Shift G Line i 3 af gt Colourshitt a
61. to the setup in the Show Editor menu Settings Start Stop Laser output automatically the laser will be switched on automatically or not The same is valid for the DMX output It is possible to click repeatedly onto Record On each click the record starts at the selected start position Hint It is possible to record on several tracks simultaneously To select several tracks of the same kind use the Strg key on marking with the mouse For example for a fading off of a figure select the three tracks for R G and B gt Button Jump to Start k This button stops the replay or recording and the start position is set to the start of the show According to the setup in the Show Editor menu Settings Start Stop Laser output automatically the laser will be switched off automatically or not The same is valid for the DMX output gt Button Stop o This button stops the replay or recording According to the setup in the Show Editor menu Settings Start Stop Laser output automatically the laser will be switched off automatically or not The same is valid for the DMX output gt Button Loop If a region within the Timeline was marked for play record by using the left D mouse button pushed then the loop function can be activated The loop function will replay the marked region endlessly The loop region is valid until it is deselected or until a new song position is chosen 118 161 00066470 DOC Version 1 0 EUROLITE H
62. value are defined The 151 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor Oxygen49 Keyboard e g has enough keys some turning knobs and sliders and thus is suited very well Push View MIDI Monitor Now you can see a small window which shows the MIDI events when anything changes at the MIDI keyboard the green keyboard in the picture In principal the setup of MIDI is very simple select at Options MIDI a MIDI keyboard Then open the MIDI assignment You can see the window shown in Fig 134 Live Window Timeline f1 v Kanal Figure View Midi Monitor Size Rotation Compression Message Nr Compression Y f 76 Intensity A Intensity G DataValue z Intensity B Datal C Data Comp Axis Comp Axis f Value 7 Rotation Center x Fotation Center Me Use Value from Displacement x C Datai G Data2 Displacement Y Frame Number Rotation 2 Rotation 2 Y Rotation 22 Intensity RGB Virtual Midi Controller LE Fenster Live Fenster Show Editor Laser n E Virtual Midi Controller MIDI Zuordnung speichern MIDI Zuordnung laden Reset MIDI Zuordnung 2 Nr Data 1 und Data 2 ensters zB Rotation en Spei Widi In Status E INSTANT III und tr gst diesen Wert bei Data Value ein hier war das Ordner 1 Data2 84 t den Effektwert bestimmen soll hier ist das Data2 v Fig 135 Live Window MIDI assignment an
63. very interesting results When you are ready to draw the path push the button Next to go on in the process If you are not satisfied with the path push the button Reset to clear the window If you want to take the path from a figure of the Figure Editor it could be useful to apply the function Optimize Distance via the menu Windows Special Functions Opt Distance to add intermediate points on straight parts of the path B Path Treatment Window With the Path Treatment Window Fig 73 it is possible to smooth the course of your wie path via the button Smooth You can change the number of points which describe the path too button Number of Points If the path was taken from a figure of the Figure Editor it is in the most cases not recommended to use the option Smooth because then the corners will be rounded If the treatments are done click the button Next to go to the last module of the Path Tool C Selection of Figure and Options ai Noe ie With the help of this module Fig 74 you can select the figure to move along the path This could be the currently selected Fig 73 Extra Tools Path Tool Path Treatment 80 1 Window EUROLITE HE Figure Editor figure from the Figure Editor Option Source Use frame from main window or a snake Option Source Snake Line If Snake is selected then a serpentine will be created The length of the
64. which will be displayed with morphing 5 Phothic 5 Pincha 5 Ul Gothic NSimoun Fhin CP MingLiL ExtB E Fig 34 Figure Editor Dialog for text options click with right mouse button on the text tool EUROLITE HE Figure Editor After your selection close the dialog by clicking the yellow button Close Window Click the tool in the Figure Editor again after you have selected the desired color In the painting window click the position to display the text position of first letter A small dialog to enter your text will open Enter the text and confirm with OK The text will be inserted This procedure is suitable for single words Longer texts will be cut at their end You have to change the size or write the words separately e g one below the other Long texts animated gt Morphing Text These kinds of texts are created only within the text dialog Fig 34 The option Morphing Text must be selected It is also possible to set up the size and quality as well as the font Click onto the tool with the right mouse button to open the text dialog Now you can enter your text in the text box on the right side of the dialog By clicking Create the creation of the text is started A new figure consisting of several frames will be created automatically The program tries according to the settings in the options menu to separate the words of the text at appropriate places It will be morphed
65. will act exclusively on these controllers scrollbars Thus the value of the scrollbar determines the current behavior of the figure Pay attention to some important things These are the options Auto Boot Always same start direction and Absolute Value Dependent on the settings and combinations of these options the effect value has different influences to the effect Auto Boot This option determines if on calling the figure via the show or via a click the figure or via DMX the last used effect value of the left scrollbar will be preserved if its not checked or if at every time on recalling the figure the preset value of the scrollbar Start Value will be used as start value when the option is checked This option thus can have an extreme influence on the show Example Auto Boot is active for Rotation the Effect Value is set to 0 That means on calling the figure the Rotation has firstly the value O clear but by somewhat manipulation e g via Show Editor the value can be changed and the figure will rotate Now other figures are called Thanks to Auto Boot on a second calling of the prior figure this will not rotate any more the value is set again to 0 If Auto Boot had not been activated then the figure would rotate still as on that moment when it was replaced by another figure Always same start direction This option is only active when Auto Boot is activated too Thus it will be deactivated automatical
66. you can see the five scrollbars upper right They serve only to modify the effects via mouse or touchscreen For each key you can prearrange which of all possible effects should be modified via the scrollbars Generally all effects are adjustable for every figure key If the Live Window is controlled via DMX or MIDI all effects can be accessed 31 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start simultaneously The scrollbars are not updated when they are controlled via DMX or MIDI The Live Window thus has 18 effects and not only 5 DMX assignment For each key you can determine the DMX values which are called by pushing it The DMX input mapping for the Live Window has to be considered which channel serves for the values In the basic setting DMX channel 1 is always responsible for the selection of keys DMX channel 19 is responsible for the F key selection This mapping can be changed If no DMX assignment was set a control by DMX is not possible MIDI assignment Here you can adjust which MIDI value will call the assigned key DMX and MIDI do generally nothing else but to push the keys virtually In the beginning it may be a little confusing which mapping and which assignment will result in which action in the respective regions Summary of routings mappings and assignments Assignment of keys Figures are assigned to keys Pushing the assigned key will call the figure for output MIDI
67. 270718 Dongle Mo with rights to save files eal Programme Apply to Frames and Show E Buchstaben_ 3D Shaddow_Avrial J Buchstaben_ 3D Shaddow BankGothic E Buchstaber_ Normal C FieFiguren I Delete unused files in Showfolder Close Window Fig 104 Show Editor Show Dongle Protection The aim of this function is to protect shows and figure files against unwanted access Click the menu item and the window will open which is shown in Fig 100 There are two variants to protect shows a Only one single show or b All shows within a folder The left region of the dialog with the button Apply to Frames and Show is used to protect the currently loaded show The right region serves to protect all shows which are stored in the selected folder and its sub folders Then use the button Apply to all Shows If the option Delete unused files in Show folder is additionally activated for protection all unused figures are deleted This option can be used without the protection function too Then enter for the dongle numbers 0 Before you protect shows please make a copy of them for safety The dongle numbers are used for both variants e Only the Dongle No enabled to give rights can change the rights e If all numbers are 0 in the textboxes no rights are given to other dongles The show is then without dongle protection 126 161 00066470 DOC Version 1 0 EUROLITE HE show Editor e Only when the cu
68. 96 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt Selection of Language Click the respective radio button to choose your desired language If for a certain language the translation is not yet available the English translation is used for the respective caption gt ILDA Color Byte Order This is a special option which is not stored within the ini file Reason of the option Unfortunately there is much confusion concerning ILDA files Thus there exist two kinds of ILDA files with different order of the colors RGB or BGR When you notice that the color order of R and B is inverted importing or exporting an ILDA file then you can set the respective option import the ILDA file and afterwards store it as HE file With the new start of the program the option is set again to the default gt Monitor action during playing HQ or Playlist shows With these three options you have the choice to control your monitor s on playing a show in HQ mode or via the Playlist Show Dark Screen makes sense only with one monitor A black window is displayed on which is the speedometer is displayed if activated For old CRT displays monitor with tube not LED LCD etc that was is a Suitable option With LCD monitors you will still see the background lighting gleaming When using LCD monitors or if you have several monitors the option Switch Monitor Standby is recommended Via this option all monitors are switched dark But t
69. A simple way to find out the free keys offers the Live Window 64 161 00066470 DOC Version 1 0 Figure Editor ia Live Window E E lej xil Fie Controller Assignement Show options r Key options Size v siz Size v Size Size Liye Show Name 7 Use Key Up Event Flash IV A M Swich off unused tracks IV Oo PREC DMX Assignement Dix Start Value Suipi Trush 2 utomatic Mode 255 i Jui k Trask 5 255 v Duig Wack 4 DM Stop Value Iv ou Window on top Cutout ERG Assign all keys to DMX Apply my Duio Track 7 Save live show Midi Mapping v Digt Track amp Laser On 255 4d A Ouiput Track 3 Ee A Oui Track 10 Map Midi automatically Apply Quiput Tract 11 Zea PARR 2a yey Pn i ig gt i 3 i i 7 GN A Fig 59 Free keys shown in the Live Window all green keys O lieso live O lieso Within the Live Window all keys without a figure are backgrounded with green color 5 2 12 5 Menu Frame Tools Frame Tools Windows Colour Table SignsiTexk Test Pickure Info Help Mew Frame Delete Frame Insert Frame Copy Frames A gt B into Clipboard Cut Frames 4 gt B6 and Copy into Clipboard Change rendering direction of Frames in clipboard Paste Frames 4 gt 6 from Clipboard Actual Frame and Following will be moved backwards Add Frames 4 gt 6 from Clipboard Begin at actual Frame
70. Comp xis Y Rotation Center x Rotation Center Y Displacement Displacement Y 4 4 m TT v v 4 4 4 4 i 4 4 i a Frame Number 4 Rotation2 lt 4 Ratation2y Rotation2Z Reset Reset Reset Reset All Image Copys Beam Switch 1 Copies Xx Axis ree M Margin visible 1 Copies Y Axis Shadow 100 aiza 1A OOR f not I Use Soft Colour 0 Displacement D Displacement Y C Top Left C Bottom Right v P Miror x Axis P Mirror Y Axis ner Perspective 4 l gt 32700 Effekts Limits Flip Flop 100 100 S a3 da W039 SE Fig 27 The Effects Window 34 161 00066470 DOC Version 1 0 EUROLITE HE Main Part The Show Editor also called Timeline is used for the creation and the replay of a music synchronous laser show The window includes Tracks On the subtracks the events figures effects etc are arranged These events call the figures and activate their effect controls Short explanation Every figure has its own basic settings of effects These settings can be changed by the Show Editor i e by remote control ia Show EditorEvents 16398 2min 3sec 122762 ms 5 x File Showpart Edit Tools Settings Video Play List Info txt Countdown G iDokumente und EinstellungeniubianchilEigene DateientHE Laserscan_4irunaway Runaway Runaway a a a 0 gt gt i4 m Beton gt
71. Devise sts i in Hardware 16 No Device 0 E ia ountdown Output Fig 8 Dialog Options Hardware Output routing of the four pages A B C and D see Fig 7 with each 3 figure tracks and their effect subtracks to the hardware with up to sixteen DAC 15 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 5 Start of the Program To start the program click its icon small pictures on your computer screen After the start of the program you should see the main window on your screen like shown in the picture below Important If the software is be started by double clicking a file with ending ini or shw assigned to EUROLITE HE the path to that file must be without any empty spaces The development software VB can not handle that After launching the program you should see the main window of EUROLITE HE as shown above in figure 9 The design of this main window of the program is always a little bit different in the various versions and also dependant on your settings of the system File Background Image Edit Figure Assignment Frame Tools Windows Colour Table Signs Text Test Picture Info Help Figures Always on Top Output Path fA 0 sa Frame Tools Undo Redo IZ N 4 ols ol Ss File New Figure Sauerstoff Fig 9 Main window Click Options for hardware setup see red arrow 3 6 Verifying of Settings Normally the program automatically finds
72. E 5 4 1 10 Further Show Editor Elements gt Track Page Selection A B C and D these are the possible track pages Each track age contains 3 tracks with each having 19 subtracks for the figures and effects Via the Options Dialog Index card Hardware the routing of the pages can be done free up to 16 projectors see the respective chapter To change to another track page just click the respective radio button gt Figure and Effect Subtracks Here the figures or effect intensities are stored Each subtrack is the container for the respective effect intensity or figure To record events on a subtrack the desired subtrack must be activated by clicking its caption The green background will then show the readiness for recording When several subtracks shall be recorded in one step e g all three intensities for RGB then hold the Strg key pushed and click the desired subtracks show Editor oe onmp a Eiaa Menacement Fig 97 Show Editor Track Pages selection Tracks and Sub tracks Effect Intensity Input yellow during recording According to the kind of the subtrack figure or effect the events are recorded via pushing the previously assigned keys figures or via the mouse and the Effect Intensity Input The functions of the 19 subtracks are e Figure Start Stop of figure callings recorded by assigned keys or by drag and drop e Size Size changes
73. E HE The TTL switches can be set up for each figure within the Effect Window button Effects On calling the figure can be an empty one the chosen TTL switches are activated this is valid only for the lowest subtrack on a sequencer page 3 3 10 MIDI Hardware and Driver Each installed MIDI port on the PC should be recognized by EUROLITE HE and work including virtual ones MIDI is used to control the Live Window the Timeline or the Playlist too In the Show Editor it is used to control the figure changes and effects e g for recording the show It is easier and more comfortable to use a MIDI keyboard for playing the figures than to use PC keys After a new installation of the program there is no MIDI port selected initially To select a MIDI port open the dialog Options MIDI DMX Printer Fig 6 and click Change situated above the text field Selected MIDI Port A dialog to select the desired MIDI port will be opened Only the MIDI IN port is used Perhaps the MIDI routing must be adjusted Please read the chapter Software Control via MIDI DMX Tip For MIDI control use e g the M Audio Oxygen 49 It has everything needed for MIDI control MIDI is somewhat curious and circumstantial but every device should work Generally the control of EUROLITE HE Live Window is much easier via DMX 3 4 Routing of Hardware Output The routing of the hardware output is very simple but nevertheless incredibly flexible and powerful
74. E HE Quick Start down the Strg key To work on or mark ALL points of a picture frame you can use the menu gt Edit gt Mark All Points Marked points can be moved with the right mouse key If no points are marked the point just situated under the mouse cursor will be moved It could be necessary that in order to mark the points you have to switch off the grid because otherwise some points are not reachable To do that enter the value 1 into the textbox for the adjustment of the grid The functions Rotate Change Color Delete and Optimize work all in aes same manner If points are marked already when you use these functions the respective points will be edited immediately deleted changed in color etc Otherwise the respective function will be valid for only the point situated under the mouse cursor A The Magnifying Glass is used to magnify regions of the painting window Meanwhile also the Magnifying Glass is very flexible You can use it to mark a region within the painting window to be magnified Alternatively you can use it in that way that you click the tool then move with the cursor onto the painting window and at least use the scroll wheel to zoom in or zoom out of the picture Clicking the right or left mouse button with this tool yields different results The left mouse button enables zoom set to 100 The right mouse button allows zooming with the currently set
75. EA E EE EEEE 80 9213 DUC ICMEINGS POO arias Ea E 82 92 194 DUM lace TOO cuspe a a AEAEE a 83 5 2 13 5 Push Through Colors Move Colors Through cccccccseceseeeeeeeeseeeeeeeeaes 84 5 2 13 6 Insert Color Gradient Insert Smooth COlOL eee eeccceeeceeeeeeeeeaeeeeeeeaes 85 SA WA EGU DAO seen ace croeesseisiee dete poco cetacean cae eens E 86 9 9 OPUONS sicaire ai OTA i ai ai 90 3 ee Aad I g EE E E E E E A eee ee TEP EE eee 91 Di INDEX Card SNOW sssrin A R EE OTNES ETER EEES 92 0 0 9 INdEX Card MIDIVDMX siivisacnsancivanaesapsbsnesseunsundivectionsnsiaxtapensdienstbertelennsactdactiudaunteands 94 5 3 4 INdex Card Others ccccecccecceeeeeeeteeeteeteeeceeeceeceseeegeceueeeeeteeeteeeteeceneeeneesneeeaees 96 5 0 0 INDEX Card OPUiMIZS OUMU sses rns Ere aT aE EEIE ATIE ONENE 98 5 3 5 1 Adjustment of the PPS Rate Instructions 00nn0nnaannannnnnnennnnnnnnnnnnennnne 101 5 3 5 2 How to set up the Output Optimization Instructions ccececeeceeeeeee ees 102 5 3 6 Index Card Hardware ccccccceccseeceeeceeececeteeeeeeeseeeseeecseeeeeesaeeseeeseetseeteeeteeeees 104 OO Maex Card OUO eenean EE E EE 104 5 3 8 Index Card Color Correction cccccceeccsecceeeceeeceeececesseeeeecseceeeeeseeeseeeeeeeeeenes 107 5 3 9 Index Card Reset SettingS cccccccccseccceeeceeeceeeceeceeeceseeeeseesegeeseeesseessgeees 111 5 3 10 Buttons at OptONS cctatancacurnaamsaannaneranceuac rasa aa Aaria EE NE ini
76. EBE EUROLITE HE DMX Editor 5 5 1 1 Region Macro Steps gt Button New Step a E This button adds a new step after the current one Mew Sten Talata O CICLE gt Button Delete This button deletes the current step I gt gt Button Insert No of intermediate steps This button adds a new step in front of the current gl r one ms per intermediate step 4 r gt Button Seconds per Step s This button opens a dialog to enter the duration of a Fis 119 DMX Editor Region step in seconds Macro Steps gt Scrollbars No of intermediate steps ms per intermediate step With these scrollbars fading between steps is possible The nominal values of a new step will be set with small intermediate steps For this the number of intermediate steps needs to be set with the respective scrollbar 1 means that the nominal values will be taken immediately Value 2 means one intermediate step and so on With the scrollbar ms per intermediate step the delay for the intermediate steps is fixed A reasonable value is e g 30 or more milliseconds for each intermediate step faster is not recommended because the laser output will be hindered visibly by many DMX outputs Hint The intermediate steps the dimming will work at intelligent DMX devices only when the option dimmable was checked set to true for the respective channels More information will be given later in chapter Intelligent DMX
77. EUROLITE HE recognizes and organizes the hardware cards generally by their series numbers If the FriendlyName was changed with other software it has no influence on the order of cards within EUROLITE HE If a previously via Options Hardware selected and stored card is not connected during the start of the software then a message about the missing card containing their series number is displayed This message is sometimes regarded as uncomfortable But it makes sense when bigger setups are made it is good to know whether all cards are ready to use You can prevent the appearance of the message by using only Virtual Devices with the above explained techniques to use several ini files 12 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 MIDI DMX Hardware and Driver The setup of the MIDI and DMX hardware is done in the dialog Options MIDI DMX Fig 6 Text Show Others Optimize Output Reset Settings Output Colour Correction ELATI Pa Hardware po j 50 OMes Channels Options for printer fio Print yfidth for 1 octave Pens GURU Ere Output i Bo Mo Device Print Height for 1 octave OM through MID DMes Parts Selected MIDI Part Change Input No Device I F ee NotEnabled Potd f Automatically if live window is oper Mot Enabled Port 0 I Ignore Size Contral E lnput lnteryal When Laser Output is stopped in ms 5000 Input lntervall when Laser OQutput i runnin
78. I code Thus users of QWERTY keyboards have to reassign the KeyCodes To do so select this item and then push every key of the keyboard The new KeyCode Assignment is saved within the INI file It is very strongly recommended to do this before the creation or the loading a live show The menu of the Live Window should be self explanatory 159 161 00066470 DOC Version 1 0 EUROLITE HE show Parts 7 Show Parts It is possible to create parts of a show and save them within the show folder These show parts appear in the Figure Table can be assigned to keys and used within a live show or in a laser show respectively There are some limits to remember e A show part shall not contain callings of other show parts e If several show parts are running at the same time the event called last has priority Eventually it can come to chaos if one show part terminates another one possible e Remember Show parts are no figures or animations but only calling lists for figure changes or changes of effects e Generally each show part should be arranged in the way that after its run the figures called are terminated this is not a must but is recommended Basically the creation of a show part is done as for normal laser shows But only a part of a show will be created e g for a refrain This part can be used several times within a laser show it is not recommended to use the same part for a chorus every time it could become bor
79. Info txk t see also chapter 5 2 12 6 Menu Windows Use the beat counter to detect Beat Counter the beats per minute bpm of a song It is Move all events in timeline very helpful to set the appropriate frame Move Events behind current timeposition rate of multi frame figures By clicking the Delete unused files Fram show folder menu item a small window opens The Fig 106 Show Editor Menu Tools clicks with the left mouse button into the small black area are counted Their temporal distance is calculated and displayed as a bpm rate With the space key of the computer keyboard the counting can be reset 127 161 00066470 DOC Version 1 0 EUROLITE HE show Editor By clicking the menu item Move all events in Timeline a dialog for the movement of all events of the show in milliseconds is opened This could be useful if you want e g to delete the first part of a show shorten music and then move all events by the time by which the music was shortened and vice versa gt gt A _ __ Menu item Move events behind current time position will basically do the same but it acts only on the events of the show which are positioned behind the current song position To define the current song position first click the respective place within the Timeline The current song position is then marked by a red line followed by a double arrow If events are moved backwards negative direction pay attention to overla
80. Intensity Input range 0 120 e Rotation Rotation changes Intensity Input range 180 e Compression x Compression changes along x axis Intensity Input range 0 100 e Compression y Compression changes along y axis Intensity Input range 0 100 e Intensity R Intensity changes red Intensity Input range 0 100 e Intensity G Intensity changes green Intensity Input range 0 100 e Intensity B Intensity changes blue Intensity Input range 0 100 e Comp Axis x Movement of compression axis x Intensity Input range 50 e Comp Axis y Movement of compression axis y Intensity Input range 50 e Rotation Center X Movement of rotation center along x axis l l range 50 e Rotation Center Y Movement of rotation center along y axis l l range 50 100 e Displacement X Displacement along x axis Intensity Input range 50 e Displacement Y Displacement along y axis Intensity Input range 50 e Frame Number Selection of frames of multi frame figures l l Range 0 119 161 00066470 DOC Version 1 0 EUROLITE HE show Editor e Rotation 2X Rotation around x axis Intensity Input range 180 e Rotation 2Y Rotation around y axis Intensity Input range 180 e Rotation 2Z Rotation around z axis Intensity Input range 180 e DMX Macro On Off of DMX macros gt Effect Intensity Input With the help of this function effect intensities can be re
81. OLITE HE Figure Editor 5 2 10 Folder Window Here you can select the folder to store the created figures or open the already existing ones Above the Sc E window with the tree you can find a list box to select ac the drive Fig 48 On selecting an existent folder all a a figures which are loadable by EUROLITE HE will be SHE EJ Free_Shows_Vollyersion loaded and put into the Figure Table E a Explode 2 ILDA figures are no EUROLITE HE files and must be imported manually via the menu File of the Figure 8 48 Folder Window Editor lf a show is loaded via the Show Editor the content of the window will be updated automatically with the respective path of the folder There are some special folders present in the program folder of EUROLITE HE Fig 49 a C4 3 Programme C Buchstaben_3DShaddow C Buchstaben_3DShaddow E C Buchstaben_Normal CJ FixFiguren CJHE_ s Testbilder IML Driver CJ TestBilder Wave Geneator Settings Fig 49 Special Folders Folders named Buchstaben_XXXXX contain self made letters The folder FixFiguren serves to store figures which can be called from every show These figures are displayed together with the test pictures within the table of the test pictures menu Test Pictures Show Test Pictures These figures can be assigned to keys as usual For example it is very useful for mirrors distributed in your show room Here you can define so
82. RGB file is exported A separate conversion to HE colors is possible see above Special Functions button Change Color Values to HE Values and even sometimes necessary if the ILDA file shall be used together with other HE figures 72 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 12 8 Menu Signs Text gt New Text or Sign With the help of the menu item Signs Text Fig 67 you will Ssigns Text Test Pictur open a dialog Fig 68 to create your own signs and letters New Text or Sign A and or to display longer text passages B with the laser Enable SMS projector Fig 67 Figure Editor Menu Signs Text Create Sign Font 100 Font Size Close window Options A Z ichen zum Abklicken eintippen Delete last Point Sa 4 Quali Bo HiltA azter PEZAN Km H ae Bold 700 YI 111300 T2 Italic E ScrallStep Scrolling Text Create f Morphing Text Enter a longer text into this box without word Wrapping The text will be split into several frames which will be displayed with morphing MingLill HKSCS MingLil HKSCS Exth Fig 68 Figure Editor Menu Signs Text Window to create letters and signs and to enter texts Description This window serves for multiple purposes Indeed it is not very typical for Windows because it is a very old function Perhaps it will be re engineered sometimes The window offers mainly two different text functions A Create Sign
83. The EasyLase test pictures are not stored in their original size A color change of the test pictures is not possible except at the watch Attention The DAC output of the test pictures is not optimized They are generally used to measure the PPS speed of your galvos ILDA test picture Please use the HE Testbilder to set up the software and your Galvos to get optimal show results All pictures can be assigned to keys and thus be used in shows To close the test picture table please uncheck the menu item 79 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 13 Tools to Create Automatically Animations These tools can be reached via the Windows menu of the Figure Editor They shall help the user to generate different figures automatically Sometimes it is not easy to handle these tools thus a little training is recommended The combination of several tools can create impressive effects e g Color Gradient Push Through Colors and Stretchline used one after another or similar combinations 5 2 13 1 Wave Generator ioi x Wave 1 Assignment Wave 6 Assignment 4 J f Frequency B 4 J rif Frequency r xX 4 J1000 Period T Iv Y 4 gt 1000 Period T E 4 20000 Amplitude Red 4 gt 5000 Amplitude Red a lo Phase l Green 4 gt lo Phase Green Sinus Triangle C Rectangle Backwards Blue Sinus Triangle C Rectangle Backwards Blue
84. TheMe _ Drumm Beat 1 heb 08 09 2006 17 27 HEB Datei B H_V_G_Juchitzer_m _ Drumm Beat heb 08 09 2006 17 27 HEB Datei B Klar_mp3 _ DummBeat3 heb 08 05 2006 17 27 HEB Datei Kid_P_BackPipes _ DummBeat4 heb 08 09 2006 17 27 HEB Datei J Mika_Grace_Kelly _ Drumm Beat5 heb 08 09 2006 17 27 HEB Datei Narcotic Liquide _ DrummBeat6 heb 08 09 2006 17 27 HEB Datei J Nevio _Amore_Per_5 _ FistPump heb 08 09 2006 17 27 HEB Datei B Nightwish _Hochzeits _ GO heb 08 09 2006 17 27 HEB Datei i Prnosong Show _ Head heb 08 09 2006 17 27 HEB Datei 08 09 2006 17 27 HEB Datei J RockKlassikTechnolje L HeadBob heb nn Oe rrr 4A 1 man a 12 KE 367 KE 55 KB 102 KB 3 KB 65 KB 54 KE 124 KB 118 KB 20 KB 13 KB 70 KB 24 KB 24 KE 24 KB 24 KB 24 KE 24 KB 140 KB 5 KB 26 KB 143 KB ra wr Dateiname miey Dateityp heb HE Bigg Dates Ordner ausblenden Fig 16 Save Figure dialog opened on first saving of a figure to give the figure a name blue arrow The creation of a new folder is also possible red arrow this dialog can look different in different Windows versions Here the German Windows dialog is shown Via the folder tree within the Figure Editor Main Window it is possible to go immediately into the desired current folder to have access to the figures stored before Loading entire shows is possible much quicker via the menu File 23 161 00066470 DOC Version 1 0
85. Then scan a test picture with all kinds of content The picture should contain at least a L shaped line a rectangle a circle some single beams points and eventually some other elements e Project the picture onto a screen and listen to the sound of the galvos switch off any music You will see the picture clearly projected onto the screen hopefully 1 1 and you will hear a buzzing or humming of the galvos depending on the type and manufacturer Keep the sound in mind and go on with the procedure e Now increase the speed by 1000pps e Look at the picture and listen to the sound of the galvos The picture will flicker less but it will basically remain unchanged The corners are sharp and detailed the line starts and ends are clear The points remain points The buzzing of the galvos may be a little more louder but generally unchanged the sound characteristics e Now increase again the speed by 1000pps e Look again at the picture and listen to the sound of the galvos There shall be no noticeable changes e Now increase the speed by 1000pps again Look again at the picture and listen to the sound of the galvos The procedure shall be repeated until the following happens e Eventually you will reach a point where after another increase of the speed the picture will become noticeable badly and the Galvo sound will become noticeable louder The corners will become more rounded points will become unclear circles will become noti
86. Tracks is controlled by 19 DMX channels 1 Subtrack for the Figure 17 Subtracks for Effects 1 Subtrack DMX can not be controlled via DMX The Subtrack DMX controls the F keys 146 161 00066470 DOC Version 1 0 EUROLITE HE w DMX Input routing DMX Editor Mi E DMX routing timeline without live window DMX routing Live Window DMX Effekt Output assignment DMX Effekt assignment fs Fue FF p rack 0 os Figure C Size Output track 1 A Size C Rotation Output track 2 2 z C Compression Jutput track 3 3 Rotation C Compression Y eo 4 v Compression X C Intensity G 5 v Compression Y C Intensity B g E m Intensity A C Comp Axis Y 7 m Intensity G C Rotation Center x P C Rotation Center r fe z es C Displacement Comp Axis x C Displacement Y Eanes Frame Number 10 ad j C Rotation 2 fi 1 Rotation Center x C Rotation 2Y C Rotation 2Z fi 2 v Rotation Center Y l Fl Fiz 13 Displacement x baie IE 14 X Displacement Y fi 5 v Frame Number he DMX Input routing depends to the REAL dmx Input Channel Less DMX Start Channel you selected in the Options Example if you select 16 Rotation 2 Start channel value 50 the REAL DMX inputchannel 50 will change the 17 Rotation 2 Y software channel 1 This is like the dmx usage with every comon device like Movingeheads or something else fis Rotation 2 Z 19 F1 F12 20 v Intensity RGB Re
87. X macros These are created and assigned to keys of the computer keyboard Afterwards the macros can be called Basically there are two possibilities to control DMX channels DMX digital multiplex e EasyDMX e Intelligent DMX only for Dongle users Intelligent DMX is in the strict sense only a push up of EasyDMxX It is a possibility to control more complex devices very easily 2 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor 5 5 1 EasyDMX The use of the EasyDMX Editor Fig 117 is similar to that of the Figure Editor but for the control of DMX devices macros are created comparable with the figures within the shows Each DMX macro can consist of one or more steps Scenes and can be assigned to a key similar to the figures in the Figure Editor After the creation assignment and storage the macros can be used In Fig 117 a lot of vertical scrollbars can be seen on the upper side Each scrollbar controls one output channel which can be assigned to one or even more DMX channels As default each control is assigned to the respective channel number The control elements are positioned at the bottom The creation of a DMX macro works just like the creation of a figure At first you have to push the button Create New DMX Macro in the region Edit Step Via this action an empty MacroO is generated Now the scrollbars can be set To reach the scrollbars for channels with higher numbers than 50 the upper hor
88. alog to enter the number of frames to insert will open count of steps to calculate about 50 frames is practicable gt Morph All This button will execute the function Morph to all frames of the current figure A dialog to enter the number of frames to insert will open It will be morphed between frame 0 and the last frame of the figure The application is often to have smooth transitions in an animated cartoon for example you have painted 5 frames of a walking man then a smooth walking is achieved by Morph All However the assignment of the points is critical Point no 1 of the start frame will be no 1 of the target frame too When you mix the order of point numbers then the display of your figure will be warped Thus it is reasonable to paint firstly the picture in the start frame then to copy the picture to the following frames the numbers of points will then be conserved and at last to shift the points of the pictures to their end positions to achieve the desired movement After that you can use Morph All to get a smooth movement in the cartoon Another trick Amazing morphs which are often seen in shows are made in the following way First a figure is created for example consisting of several single planes e g 4 planes beneath one another a broken line Now 4 new frames are created with the same content Then the first plane is moved upwards in the first frame in the second frame only the second plane in th
89. alue of the selected will also be affected Its new value then could be the average of 0 and the current value and will possibly be too small gt Linear Time Raster between Min and Max Values The function activated by the respective button looks for the highest and lowest effect values and generates between them a linear slope by using constant time intervals The time intervals can be adjusted via a right mouse button click of the button gt Werteraster zwischen Minima und Maxima Value Grid between Min and Max As above for the time raster at first the minima and maxima of the course of the effect are calculated Afterwards the function creates a linear curve of interpolation points between them but this time with constant steps of effect values 1 The time intervals are chosen by the function in that way that the effects are called when a whole step occurred By doing so smoother effect courses are achieved but on the other hand very much effect events are created gt Time Raster This function fills breaks in the course of the effect It generates constant time intervals between the effects By E OMe Macio e melita lor using this it is possible to reduce the amount of effect A jetotallonc y callings The time intervals can be adjusted via a right C B fee op mouse button click of the button cE Displacemer enp fe Displacement Je Bote on Lente gt Value Raster ae This
90. among the generated frames all is done automatically Finally a dialog disappears In the painting window the first frame is shown To see all frames use the scroll bar of the frame tools Now you will also understand the meaning of Morphing Text Long texts animated gt Scrolling Text These kinds of text again can be entered in two different ways A Within the text box where also the animated morphing text is entered see above For that you have to change the option to Scrolling Text But an additional thing has to be recognized The 4 coordinates position describe a rectangle within the scrolling text will be moved The values of the X and Y coordinates lie between 32 67 and 3276 If the rectangle is set to small then only parts or even no text will be shown Because it is hardly possible to imagine the position of the text by the coordinates a second possibility B is available It shall be noted that a new figure will be created thus existing elements will be deleted in the painting window B N Creation within the Figure Editor The text can also be created by firstly making the setups in the text dialog selection of Scrolling Text size font quality see above and closing the dialog afterwards Now you can select the text tool within the Figure Editor and draw mark the position rectangle within the painting window This rectangle will generate the suitable coordinates for the position of the scrol
91. ane von z a Lop er ere Qat plug ins Fig 64 Setup of Winamp plug in Winamp Options Visualizations Select plugin and Softwarecave logo upper left corner If the current average signal level is higher than the selected limit Minimum Level and when the peak level is a certain value Sensitivity higher than the damped average a random figure is called from the Figure Table for the respective track and put out to the projector For every track an individual setup of the Minimum Level and the Sensitivity is possible The adjusted values can be identified on the vertical lines within the frequency spectrum If the intensity value of the respective frequency band falls below this lower limit no figure will be displayed at all You can perhaps imagine that the best setup of the limits is different for each song Thus you will have to experiment a little with the values until you will find the best for the laser display of your songs With the buttons Save and Load you can save or load the settings of the automatic player Reset everything will carry out a full reset With the scrollbar Sampling Rate you can set the interval to update the intensity value by the frequency analyzer For fast computers it is recommended to increase the sampling rate Winamp also can evaluate the PC s line input for DJ music Enter linein as URL The stored aut file with the automatic settings can be started v
92. as the same function as the click with the right mouse button on a figure of the Figure Table Delete Figure The selected figure will be deleted in the Figure Table and will be removed from the hard disk too After deleting the Figure Table is loaded again gt Import ILDA This menu item serves to import an ILDA file figure The import of ILDA files is only possible via this menu item With this function 2D and 3D ILDA files with or without color table or RGB data can be imported and converted to EUROLITE HE files Often it will be very problematic to import ILDA files because the ILDA Standard is used very flexibly by some programmers In most cases the import will be successful If any messages are displayed please read them carefully and give your answers according to your requirements Currently the import of ILDA files up to the format 5 is possible Hint Because of a faulty interpretation of the format description different RGB ILDA files exist Some have stored the colors in the byte order red green blue But this is not correct Correct is the order blue green red So if blue and red are swapped then before you import the file you can reverse the order in the Options gt Others This setup works on import as well on the export of ILDA files Additional hint Many existing files use the Pangolin color table In this case you should firstly 59 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor load the
93. be a line rotated by 45 to the axes To get a circle we need for one of the axes a cosines oscillation Now remember the basics of trigonometry A cosine function is the same as a sinus function with a phase shift of 90 when sin x 1 then cos x 0 and sin x 90 0 and otherwise All waves can be created as triangle or rectangle oscillations and the display can be altered in the direction backwards too 77 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor HINT The generator is designed to be very flexible There were some requests of users to accept only certain conditions in order to simplify the handling But this would restrict the flexibility Because the flexibility has higher priority some circumstances have to be taken into account Problem 1 Long times for calculations and very big files If you use values for the frequency and or duration for the different generators which are not integer multiples from each other then the time to calculate the wave can need very very long time Furthermore the size of the file will become big because very much frames are created The reason is that the calculation will be finished when the start situation is reached again The last frame must fit to the first frame in order to avoid a jumping display If the setups of the generators are integer multiples from each other you can see when starting the preview In the upper border of the window you will see how many
94. be put out without interpolation any liability for damages of the galvos is excluded gt Frame Start Point Repetition Here the number of additional blanked points is entered which will be put out at the place of the first point of the figure The number is automatically increased if the value for the Color Correction is negative The value can not be smaller then the number of color shift points Generally this value has no more a big influence thus the smallest possible value should be entered gt Frame End Point Repetition Here the number of additional blanked points is entered which will be put out at the place of the last point of the figure The number is automatically increased if the value for the Color Correction is positive Apart from that the same is valid as for Frame Start Point Repetition gt Scanner movement if output is off This region has two different applications On the one hand this function should be of interest for all those users who have a safety circuit short Safety built into their projector A Safety is monitoring the scanner movement In case of an error no movement for a longer period a shutter is activated to switch the lasers off this is duty for audience scanning in general There are different kinds of safeties Some of them monitor the intensities of the lasers too If no laser output is present the scanner movement doesn t need to be monitored If the safety do
95. ble via drag and drop to put the figures to a figure track within the Show Editor Up to three tracks for each output path routing are possible Up to four output paths pages A B C and D are present Thus maximally twelve figures can be put out simultaneously With the help of the Effect Tool see red arrow in next Fig 22 it is possible to change the effect values After the click first mark a region via pushed left mouse button within the desired effect After marking the appropriate track section the dialog shown in Fig 22 is opened There the course of the effect can be drawn The method is simple but also most imprecise to create a show Precise information on how to use the tools of the Show Editor is given later on in this manual Show Editor F sents 1 dt Sagfngs PlayList Info txt Countdow n easel elai Undo z cje 0 HN Tn a0 Mann Time Raster i ili 0 0 0 Intensity B 0 Intensity G Fig 22 Dialog of the Effect Tool Show Editor 28 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start Method 2 recommended Live recording as with a MIDI sequencer or i track recorder etc Via this method the commands to change the figures the effects and so on are directly entered live and recorded real time by the program Mark the track s of the figure s or effect s to be recorded see blue arrow in Fig 23 To mark several tracks hold the Strg k
96. board without deleting the original With Paste the events stored within the clipboard can be put to the currently selected subtrack on the same time position as the original 5 4 1 7 Button Play HQ gt This button needs a special explanation It is used to start the playing of a Ha Show in high quality Start means that after a click the button and after a certain adjustable time the monitor screen will be blacked out the outputs to the windows will be stopped and the show will be displayed The start delay can be adjusted by a right mouse click Furthermore the show will surely be started at its beginning and all effect settings will be reset Generally for a presentation of shows this button should be used The Playlist uses PlayHQ too 5 4 1 8 Buttons Undo Redo 9 By clicking Undo unwanted changes can be canceled The state after NH the last change of the editing function or after a new record will be restored Up to ten levels can be restored Redo is the opposite of Undo If the storing of the undo files lasts too long at very complex and extended shows the storing can be switched off via Options Others 5 4 1 9 Transport Buttons These buttons are used to operate the replay the record and the stop functions ca for the show Fig 96 The green arrows are the Play buttons Play and PlayHQ Fig 96 Show Editor Transport buttons the red full circle is for recording the violet arrow jump to
97. can be regulated The DMX master works like the master volume of an audio mixer HINT The DMX master controller has no influence on an Intelligent DMX device if the option Master DMX Editor Edit Step Create new OM Macro Fig 120 DMX Editor Region Edit Step File OM M asthe Start OM Output aie Reload Reset Fig 122 DMX Editor Additional elements Output Monitor Mapper sensitive is set to false Refer to chapter Intelligent DMX for more information gt Button Start DMX Output This function is similar to the Laser ON function of the Figure Editor But basically each change of the scrollbars will be put out to the DMX interface even if the output is set to OFF On starting the DMX output the step timers will be activated The start stop of the DMX output will be done automatically on the start stop of a laser show If the DMX output is stopped then the macro Note off Aus will be carried out automatically gt Button DMX Monitor This button opens a little window with the display of the current values of the 512 output channels The display will be actualized only with DMX output switched on 139 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor gt Link DMX macros with Laser Figures DMX macros can be linked with laser figures The links are done in the Figure Table of the Figure Editor via a click with the right mouse button o
98. ceably smaller e When this point is reached then the healthy scan speed has just been exceeded at the current optimization settings e Thus reduce the scan speed by 1000pps and be happy with the found PPS value If this value seems to be too slow for your expectation then change the parameters Adjust carefully the galvo drivers and or change the optimization settings Then again carry out the procedure until you can find an optimum If you should find no acceptable optimum then your galvos are possibly cheap scrap metal If the galvos will become smoking and suddenly be destroyed then they have been not worth for further tests and you should be happy that they are now killed Hopefully this instruction will help especially beginners to determine ideal parameters 5 3 5 2 How to set up the Output Optimization Instructions Settings of the scrollbars for the color shift The settings here perhaps must be done several times because they depend on the interpolation distances and the PPS rate 102 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor You can draw your own test picture for this optimization A suitable picture would be a triangle drawn with the polyline graphics tool Additionally draw some points Dye the sides of the triangle and the points with the colors red green and blue you can find a suitable picture within the folder HE_Testbilder Project the picture onto a screen or wall Open
99. corded With pushed left mouse button on this yellowish backgrounded region see Fig 97 you set the level of the respective effect intensity It is also possible to use the mouse wheel to enter the effect intensity The subtrack must be activated prior see above In the subtrack you can see the already recorded effect intensities You can also use the right mouse button to play the effect intensity but then the effects are quantified to the displayed lines like in the effect tool gt Display of the Waveform Within the Timeline it is possible to see the waveform of the song but only when wave files are used If errors occur on the display then a double click the Timeline will initiate a new drawing 5 4 2 Menus of the Show Editor w Show EditorEvents 16398 imin 16sec 76246 67 ms File Showpark Edit Tools Settings Video Play List Infotxt Countdown Fig 98 Show Editor Menus 5 4 2 1 Menu File The menu File Fig 99 serves primarily for opening and saving of shows as well as for the export and import of File Showpart Edit Tools Set ILDA files of whole shows Sea nou Hew Showpark Open Show gt Create New Show ee This item is only reachable via the menu With this Be oe function the creation of a new show starts After a click Clear Timeline this item a dialog to select the music file opens It is Export Show as ILDA File recommended to create a new show folder in advance and to put the music file into
100. correct simulation is shown clicking the reset button could help After a new installation of the software the parameters for the simulation display are sometimes very inappropriate and no simulation can be seen Another origin of a not working simulation can be a missing color correction setup for the hardware Generally no real hardware with laser output will be driven because the signals are redirected to the simulation Thus the output parameters like mirror X and size Options influence on simulation The simulation uses Direct X 8 0 or newer or OpenGL With Direct X the simulation works quicker but then the view is not very near to a real situation It is possible to simulate beam shows as well as graphic shows Also a combination of beam and graphic is possible like used in Fig 5 To start the simulation click Simulation A window opens which displays the currently selected figure s A simulation has some debility Real distributions of the brightness like the laser offers can not be simulated Heavy flickering is not shown in the simulation too But in the headline of the window the real number of points for the output is shown This could help to optimize the output for the real projector for a flickering free display of the figures If the show output shall be simulated the simulation has to be started before the show is started When a show is simulated then the simulation window will come in the foreground automatically
101. d music file wave or MP3 file must be stored or collected respectively It is recommended to organize all folders in a certain structure For example you should could create a folder named LaserShows with different subfolders like Already PreparedShows For future purposes it is further useful to sort the show Quick Start n Figures Always on c Tor i EJE J Program Files SM HE SM HE_ 9 Free_5hows_Yollversion J Tschosef Fi naa BlueM anGraphicShow_ Fig 15 Figure Editor folder window Structure of folders example folders alphabetically by their name You will possibly notice that you will have at a certain time in the future a lot of shows Linkfavoriten El Zuletzt besuchte Orte Weitere _ 1RotatingLine heb 08 09 2006 17 27 HEB Datei _ 5RotatingLines heb 08 09 2006 17 27 HEB Datei Ordner w Andheb 08 09 2006 17 27 HEB Datei p AwardShow _Nightwi _ Amed heb 08 09 2006 17 27 HEB Datei m Beautiful Stranger _ Basic heb 08 09 2006 17 27 HEB Datei D aa Pea heb 08 09 2006 17 27 HEB Datei 4 RockConzertNo_X _ Beat heb 08 09 2006 17 27 HEB Datei J Changes _ Behind heb 08 09 2006 17 27 HEB Datei Ji Escape _MNeu _ Concept heb 08 09 2006 17 27 HEB Datei J Explode _2 _ Crash heb 08 05 2006 17 27 HEB Datei J EyeOFTheTiger Ame L Crash_At heb 08 09 2006 17 27 HEB Datei a RlashD ance _ Down heb 08 09 2006 17 27 HEB Datei Ji Glenn Miller_In
102. d virtual keyboard Use a control a key or a button of the keyboard and observe the MIDI message number Data1 and Data2 within the MIDI monitor window Now select an effect now we speak of the control of the Live Window e g rotation Now enter the respective message number in the picture it is 176 The next is to check which Data value remains constant when changing the controller This value is entered at Data Value in the picture it was Data1 7 At least select the Data use Value from which shall control the effect value here it is Data2 This Data value will change every time when the MIDI controller is used 152 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor In the example it means that the values of Data2 of the volume control controller 176 Data 7 will change the rotation In that way you can work on all settings and in the end store your work as file Please remember If at Options MIDI DMX the size control is not activated then some effects size etc will not work in case they could cause a still standing beam Even if it would go in another way it is explicitly recommended to use the fingerboard to call the keys the figures because then the Note Off command can be used too to flash the figures if this is activated for the keys within the Live show At the end the assignment keys figures and also the routing MIDI values keys is done Do not forget that also a
103. d your DAC will put out 5000 PPS Then 10 frames per second can be displayed by the projector If now a frame rate of 20fps is entered for an animation then logically every second frame will be omitted On the other hand if 5fps is entered every frame will be displayed twice 52 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor This must be so The advantage is that the output will be independent from the DAC in use when the frame rate is the same The only difference will be that a faster system will display perhaps more frames per second and gives a smoother display whereas a slower system will perhaps omit some frames and thus it will perhaps display the picture changes more abruptly When FPS rate and the real picture repetition rate are nearly the same it will unavoidable happen that e g 10 frames do fit and the 11 will be omitted again 10 frames fit 11 omitted and so on This means that a movement will be displayed smooth for the duration of 10 pictures and then will make a sudden break That is due to the techniques and can not be prevented because now two timers are present which are incommensurate the timer of the computer and the timer of the DAC If such a behavior should happen it could help to adjust the FPS rate gt Scroll Bar Frame Selection The scroll bar below the button Frames per Second indicates whether the figure consists of multiple frames With its help you can select the sing
104. e The control line again shows the tangent from which the end point of the curve is arrived Again the length of the control line determines the strength of the direction change When drawing the last point you will see a preview of the resulting Bezier curve Important hint It is of great importance Eeee to understand the 4 coordinates of the two Control points f 4 Point bezier control lines as there are further variants Be see oe to use Bezier curves To change those Paint distance options click the right mouse button over DO the icon The window shown in Fig 37 will C Number of points open There the variants of the Bezier cee curve can be set Furthermore the T Last paint of figure willbe start paint number of points coordinates and the kind of construction can be determined 3 ok or 4 point Bezier refers to the necessary number of points for the two control lines The two lines will share one point i e the above explained principle will be changed a little bit Fig 37 Bezier settings a The first mouse click into the painting window determines the position of the first control point Here the Bezier curve will start b The second click with the mouse button determines the end of the curve Thus we talk about the fourth point compared to the above description hold the mouse button pushed c The second release of the mouse button defines the two points which influence the direction of the control line
105. e case when an effect does not act absolutely and when Auto Boot is activated too Example A Rotation of a figure is wanted Auto Boot is activated Effect Value shall be 20 Start Value shall be 10 That means that the rotation of the figure begins at angle 10 degree and then further the figure rotates with the speed of 20 Below Effects Limits the limits for the effect can be set With these values it is determined between which limits the effect will operate For example a rotation can be set to be between 90 and 180 degree The limits make only sense when the option Absolute Value is not activated With the option FlipFlop it is possible to let the effect go forward and backward For example the effect Displacement Y will always go upwards option not set or will go up and downwards option set At the effects displacement rotation etc it could happen that the figure is moving out of the window If the Margin visible option is checked then the figure lines which would leave the projection area will be compressed and visible at the borders of the projection area When the option is not checked the output of points outside of the projection area will be suppressed the points which leave the projection area are simply not displayed Please pay attention to this option because there have been already angry situations at Award shows due to a checked option A short explanation of the problem as it already happened T
106. e Frame It should be used only for the inspection of the just created figure on different projectors Output Path The meaning of Output Path is the following If in the dialog Options Hardware a B is selected Fig 43 Setting of Output Path for output routing Fig 44 and in the Figure Editor the output path is set to Bx then the selected Output Routing figure in the Figure Editor s Figure Table is routed pa ageer to the 1 and 2 projector So both projectors will fez rrr display the figure If in the Figure Editor the output M ot CEE Noo I En path Ax is selected only the 1 Projector will We Fig 44 Options Hardware 54 161 Setting of Output Routing 1 0 EUROLITE HE Figure Editor display the figure in this example The numbers refer to the possible tracks because each track page A B C D of the Timeline has three figure tracks This will play a role at the use of the Live Window too 5 2 8 Color Selection It is recommended to use the Color Cube because it displays all possible colors correctly The color circle Fig 46 restricts some possibilities even if it seems to be clearer The switch to cube or circle is HHHH done via Options Others EE an oe _ Lee BEAT Via a click the respective place of the Color Cube Ha Fig 45 or of the Color Circle Fig 46 you can easily select the desired color To get other colors in the i depth of the cube use t
107. e during the optimization of the output see next chapter The advantage here is the fact that figures with color gradient applied via this tool can be modified further by other tools e g Push Through Colors Path Tool The usage is already well known from other tools 1 Create a figure 2 Save the figure 3 Select saved figure 4 Apply the tool A new figure with color gradient is created In the dialog Fig 78 a value can be entered which is used to divide the distances for the stepwise change of the colors Please enter distance for Softcolor Abbrechen EE Fig 78 Extra Tools Dialog of Insert Color Gradient 85 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 14 Effects Dialog Effekts Fenster mi ae i pE Auto Boot rasa bart ff e ct Valu e Start Valu e Absolut Yalue Effekts Limits u m u m 4 b oe mo 4 b oe mo Aee o gt eo mo Aee a mo 4 Reset a gt Reset 4 gt Reset 360 Copys Beam Switch Copies x Axis ITITI TT Margin visible Copies Y Axis Shadow pa gii M Use Soft Colour i Displacement YY r Top Leit C Bottom Right P Miror x xis Reset P Mirror Y Axis mane 4 r 32700 Fig 79 Figure Editor Effects Dialog are Rotation Compression X Compression Y wo a m Intensity A Intensity G Intensity B D Ti Comp Axis x Comp Axis Y Rotation Center X Ratation Center Y mu Di
108. e laser beam moves as your pencil when you paint pictures from one number to the next one painting by numbers The moment the software puts out a new point the galvos driven by the preset electronics will be set to move to reach that point Then the galvos move the laser beam to the next point and so on This can be done with the laser turned off blanked or on The different colors are generated by a modulation of the intensity of differently colored laser beams To do all of this some time is needed until the mirrors are at first accelerated step on the gas to reach the next point and then decelerated throttle down or brakes on to hit it more or less exactly and until the lasers are set to the desired intensities until other devices e g DMX devices are switched on or off and so on Because of all these actions some delay will always be present Thus you can perhaps imagine that the achieved result is not always the optimum 100 of the desired figure Some additional words on colors Today we have laser diodes in general red beams or so called DPSS lasers Diode Pumped Solid State with beams in various colors With the three basic colors red green and blue every color impression can be created within our brains Color is not a physical but a psychological phenomenon Thus people will have a different impression of laser shows The three sensors for red green and blue are within our eyes In the pas
109. e manually Sometimes it makes sense to move the first figure on track 0 a little to be simultaneous with the music Because then it can be assumed that the end will not fit the frame rate has to be adjusted 125 161 00066470 DOC Version 1 0 EUROLITE HE show Editor If the frame rate which is proposed by the program is not a natural number but a broken one like 23 345 then that is a hint of an incorrect frame number of the ILDA file or a wrong length of the song file respectively Sometimes you need some patience for some shows the procedure works very well It is astonishing that other programs have no problems to import the ILDA files but on the contrary can not export ILDA files which can be read by this software because in general ILDA is created for an exchange If the ILDA show is a multi projector show then the additional files for the other projectors must be imported manually Then they must be stored as figure files within the show folder assigned to keys and at least put into the Timeline via pushing the assigned key or via drag and drop gt Show Dongle Protection Protect all showe in folder j SFOF eee Actual Dongle Mo To use this tool enter the dongle numbers and select a Apply to all shows folder All shows in this folder Will be protected if vou have rights to do this EJ x j SOF puun Dongle No enabled to give rights Dongle Mr with rights to load files i FO aes Ta j
110. e marking square will be taken for further actions Movements are done with the right mouse button The marked events will be moved If currently no event is marked the one directly under the cursor will be moved On pushing simultaneously the Strg key during the intended movement a copy of the original events will be made and moved The movements are possible to other subtracks too if they are of the same kind as the original figure or effect If the 114 161 00066470 DOC Version 1 0 EUROLITE HE show Editor events are marked then it can be identified by their changed back color and the red back color of the hand button 5 4 1 3 Rubber The rubber works like that within the Figure Editor If events are already marked a click the rubber button will delete them Otherwise the event or figure directly under the cursor will be deleted ATTENTION Sometimes it is possible that you will forget the activated rubber and want to mark a region But with the help of the Undo button unintended deleted events can be recovered easily 5 4 1 4 Effect Tool The Effect tool is used to create effect events or edit them Click the respective button to activate the tool Then a region to insert new events or to edit them can be marked on one subtrack with pushed left mouse key not the Figure track The marked region is indicated by a yellowish background color After releasing the mouse button the window of the Effects To
111. e third frame only the third plane and so on Now the whole frame series is morphed best is to use Morph All The result will be a wave of up and down moving planes That works well because in every single picture frame the points play the same role The number of points does not change 51 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Thus it works very well and looks very amazing Additionally the color of the planes could be changed Additional hint If Morph is used between frame number 10 and frame number 15 of a frame series e g 20 frames are present then the frames 11 12 13 14 will be overwritten gt Frames per Second This button opens a dialog to enter the speed in frames per second fps for the output of the frames A frame series consisting of 50 single frames will last exactly 1 second if the speed is 50 fps This value has absolutely nothing to do with the scan speed and the picture repetition rate of the laser projector The value simply determines the duration of the animation e g a wave If the fps rate is higher than the picture repetition rate of the projector depending on the PPS rate then some frames will simply be omitted In the case that the fps rate is lower than the picture repetition rate of the projector some frames are simply displayed multiple times e g twice The speed can be entered in three different ways e Frame rate without unit If only
112. ea EE E ERE et antes iva E E EE EEES 54 SAAE ao ele 10e g E E E E E A E EEE E E 55 5 2 9 Checkbox Figures Always on TOD ccccceccceeccesceceeeeeeeeeeeeseeseseeeeeueeseeesaeeenes 55 oe O Folder INDION aA E A E 56 5 2 11 Buttons in the Region Window ccccceccceeeceecceeeeeeeeeeeeeeeeeeseeeseeeeeeeseeeaeees 57 5 2 12 Menus of the Figure Editor ccccccccccccsececeseeeeeeceeeeeeeeseeessceseeeeaeeseeeseeeeaes 58 Se 2 C216 F Eeer en E A EE A EE 59 5 2 12 2 Menu Background Image ccccccceeeceeeceeeceeccueeauecesesaueceeceeeceeeseesaueeaaees 60 SA Pero Meni EdE E ee 62 5 2 12 4 Menu FIGUFE ASSIGNINGNE ei cieicedssectimesisesvensauceiaumancielncaindceielasetoeendcevaccducnedanegqe 64 2 161 00066470 DOC Version 1 0 EUROLITE HE Content 5 2 12 5 Menu Frame Tools insceiiecaiasararn sncesisensounessiuwerannnncdyensvannapsetmasenseundwineenitonnnesadtions 65 5 2 12 6 Menu WiINdOWS srncisisicrnsnnssinstanedtennaned donprnadisnisndsicasions duiiestinwrevanenedvaneGnesraiwnesmmenwaes 67 Ar NEU Gr TNO a R 72 5 2 12 8 Menu SIGNS TOXt cccc cece eeeceececeeeceeeeceeeesaeeceeeeeaeeseeeseaeesageesaeeseeesegeeseesees 73 5 2 12 9 Menu Test Pictures and Fix Figures cccccecccececeeeceeeeaeeeseeeeeeeeeeeeeaes 75 5 2 13 Tools to Create Automatically Animations cccccccceeccceeeeaeeeeeeeeeeeeeeeeaes 76 O21 cl Wave GOClALOM rrsan aE E a RES 76 Ore P TOO een EA E E E EE E E
113. eation of figures Example Polygons rectangles line start and line end are corner points Circles have no corner points as well as waves According to the setups this is valid for freehand drawings too The properties of points can be changed manually via the wrench tool see chapter 5 2 3 Marking and Editing Tools The corner point optimization value defines a minimal number of repetitions of corner points If a corner point has already been repeated several times by the color correction then the Corner Point Repetition adds only as many points until the value is reached With a setup as shown in the above figure no corner point receptions will be done when due to a color change already 2x4 extra points has been set gt Max Distance Laser OFF The setting here defines the maximal length of a piece of a line for the galvo output when the lasers are off blanked Galvos can not operate properly over big distances without this interpolation hence this setup is important Typical values lie between 500 and 2000 Depending on the properties of the points the value entered here could be ignored But that is mostly the exception e g at circles Circles are not interpolated hence it is forbidden to pull apart circle points If for a blanked line laser OFF the distance of points is bigger then the entered value the line will be divided and additional points are inserted This is repeated as many times as all distances are smaller th
114. eb file N T e Normalize RGB Point Frame This function serves to enhance the RGB values of the single points to achieve maximal brightness There are different possibilities enhance brightest point of frame to maximum or enhance each point to maximal brightness etc Fig 62 Special Functions Dialog to access special tools The other functions should explain themselves by the names of the respective buttons or are described elsewhere gt DMX This menu item is a copy of the function of the button DMX It opens the DMX Window gt Show Editor This menu item is a copy of the function of the button Show Editor It opens the window of the Show Editor gt Effects This menu item is a copy of the function of the button Effects It opens the Effects Window chapter Effects Dialog 68 161 00066470 DOC Version 1 0 EUROLITE HE gt Automatic Mode This function is accessible via the menu and via the button within the Live Window It opens the window of the automatic laser player Fig 63 It offers two modes of operation 1 With the help of the Click Beat buttons for each of the 12 tracks a beat bpm can be entered At every beat a generator will call a random figure from the Figure Table The button Start will start the timer for the respective track and the figures will be displayed randomly 2 The calling of the figures can be done via freq
115. ed The option is set as default gt DMX Input Routing MIDI Input Routing How to set up the DMX MIDI Input Routing is explained later in chapter 5 6 Control of the Software via MIDI DMX This button opens the DMX MIDI Input Routing Window The function of the DMX Input Routing is the same as of the MIDI Input Routing 95 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 3 4 Index Card Others Text Show Others Optimize Output Reset Settings Output Colour Comection Midi DME Hardware Oth ah T f Deutsch OW UZE Clot i francais Show speedometer Nederlands when screen is f Polska Monitor action during playing HG or Playlist shows Undo File black O Obs W Save Unda files i talian W show dark screen Stile of Colour Select Pre rien tN i Spanish W Swich Monitor standby E Colour Cube i Romana I Deaktivate Maus and Keyboard Colour Circle fc Select Standard Folders Ida Colowr Byte order Show E ditor C ProgrammeSHE_ Laserscan_ Fiqure E ditor C ProgramnmesHE Laserscan_ SESE Ted ianea Playlist C ProgrammesHE_Laserscan_ f AGB Ini Files lm E port C FProgramme HE_Lasercan Automatic Settings C ProgrammeSHE_Laserscan_ User File Path C Dokumente und Einstellungen C Programme SHE Laserscan M Wave Generator Settings g Define autoload show Reset autoload Fig 84 Dialog Options index card Others For additional information see also chapter 3 7 Ve
116. ed by pushing another F key The selection can be canceled by pushing the same F key again FO is active no F key If the option is chosen the F key must be pushed and held when pressing the assigned key to call the figure The key F10 may possibly lead to problems because it sets the focus on the menu of the current program window This is a Windows function and can only be changed by using the Windows settings 128 161 00066470 DOC Version 1 0 EUROLITE HE show Editor gt Use Mouse Grid This function is only accessible via the menu As explained above it is possible to insert figures into the tracks by drag and drop Furthermore it is possible to work on the tracks by copying and moving the events To make this work easier it is possible to create a time grid The option Use Mouse Grid is then used to activate the grid or to inactivate it Of course this requires that a grid was created To create a grid automatically makes no sense thus you have to create it manually gt Create Grid This function is only accessible via the menu It is used to create a time grid for the tracks After a click the function a small window to show some instructions how to make the grid will be displayed To enter gridlines the Space key is used gt Reset This function is only accessible via the menu By using this function all figures and events are loaded anew gt Play HQ Delay 1s Also accessible via the button P
117. ed with the currently chosen color If you have just chosen black you will surely not see the digits of the time 134 161 00066470 DOC Version 1 0 EUROLITE HE show Editor Also important The countdown can not be displayed as ticker moving letters The software thus uses automatically the normal font morphing letters but without morphing Please remember to set up the respective options for text 9 4 2 11 Menu Showpath wn oiDokumente und Einstellungentubianchitbigene BateieniHe laserscan tirunaway Runaway Runaway Redraw J Timeline Fig 116 Menu Showpath When a show was loaded then you can see here the path and the name of the show 135 161 O00066470 DOC Version 1 0 DMX Editor l F F F F F F F 7 F F F F 7 TF F 7 TF F F T 7 F TF 7 F T 7 F F F F 7 F 7 7 T7F 7 F T Y 7 F T Y 7 T 7 7 T 7 7 F 1ieBRpepEe p p p fra ft pepa pps pe p7 fre ps oja j2 jes jes j5 j2 jer e jeg a0 a1 a2 js j4 a5 a6 fa as j9 po fat 42 Wa 44 45 e 47 fae JA Macro Steps New No of intermediate steps i 4 r me per intermediate step jo 4 Start OMe Output Fig 117 The DMX Editor 5 5 DMX Editor The DMX Editor serves for the control of the DMX OUTPUT of a Lumax or EasyLase card With these other DMX equipment can be controlled via the software The DMX control for DMX OUT is done generally via DM
118. eline by an external DMX program which contains a Timeline too If you are not intended to do that you can skip this chapter and read the next chapter 5 6 1 2 Now almost everything what could be controlled via the Timeline can be controlled via DMX console or computer with DMX software The laser output must be switched on first and a folder containing figures has to be selected To call figures via DMX these have to be assigned to a key and to an DMX value refer to the description of the Live Window chapter DMX assignment If You have set the DMX ports in Options you will see the DMX value of the respective figure in the z top of the Figure Table see Fig 128 In the example shown the figure Globus heb will be called by the DMX value 37 The assignment of the DMX values has to be done via the Fig 128 Display of DMX value of a assignment which can be done automatically sure Maximally 254 figures should be possible because the value 0 stands for Figure off The function keys FO to F12 can also be used for the selection of figures 145 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor To make the access to the DMX assignments much easier the DMX Input Routing dialog Fig 129 has been introduced It can be opened via Options DMX DMX Input Routing J Comp Asie O Intensity B 0 Intensity G O Intensiti A 0 Compression Y 0 Compression 1 Potakhnr 0 Size W
119. en the edges will be visible The Global Settings are valid for all generators Number of Frame Points determines the number of points of the wave of one frame According to experience are useful 50 to 200 points Experiments with only 3 4 or 5 points showed also very interesting results 78 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Frames per Second adjusts the frame rate for output when the wave is applied taken to the Figure Table This value can be changed later via button Frames per Second in the Figure Editor If its not changed then the values for the period T are correct else the running speed of the wave is changed Draw x from left to right must be used to create a horizontally oriented wave used in the example shown in Fig 1 Draw y from top to bottom must be used to create a vertically oriented wave Both options together applied will give a diagonally oriented wave If one of the options is chosen then all amplitudes assigned to the respective axis will be ignored Normalize Color Values to 255 will let operate at least one of the lasers at maximal intensity The Shutter will cleave the wave to beams The wave will consist of many beams following the course of the wave The button Apply starts the calculation of the wave and takes it to the Figure Table as figure 0 There it can be modified further e g by applying morphing to get a s
120. en the given value This is also valid for the movement to the picture center gt Max Distance Laser ON The setting here defines the maximal length of a piece of a line for the galvo output when the lasers are on Apart from that the same is valid as for Max Distance Laser Off gt Soft Color Distance If Soft Color is activated in the Effects Dialog then the value entered here defines the distance between the points to crossfade the colors Between two different colored points the colors will slowly be varied to get a smooth color transition between the points With smaller distances the color crossfade will look more beautiful the crossfade becomes smoother A value of 500 is mostly a good choice If Soft Color is chosen no extra color points will be set on line start and line end Slower galvos could need a higher value gt Max Point Distance Text Here the same goes as for Max Distance Laser ON OFF with the small difference that the distances are calculated only for letters text 99 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor HINT The optimization can not be fully disabled in general But this could be necessary if optimizations with ILDA files shall be done A possibility is to set the repetition of points to the value zero and to set the maximal distances to big values Then nearly no changes are done can be used to play very old shows But this will not disable the optimization com
121. en the mouse button is released 47 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt l Change Color Tool This tool is used to change the color of marked points First mark the desired points then select the desired color and finally click the tool The color of single points can be changed too If there are no marked points and the tool is selected then the color of the point just below the mouse cursor is changed Furthermore it is possible hold the mouse button pushed and change the color for all points which are hit by the cursor On using the left mouse button only visible points can be changed in color To recolor blanked invisible points the right mouse button must be used To work on blanked points you should make them visible in the painting window via the menu Edit Blanked lines visible If the endpoint was made visible a question will appear whether a blanked point should be inserted gt ca Rubber Tool Delete Marked points are deleted by using this tool If no marked points are present that point just below the mouse cursor will be deleted With holding the mouse button pushed all points will be deleted which are hit by the cursor gt XN Wrench Tool Optimize Output This tool is added to define the kind of optimization of the figure points separately Clicking the button will open the dialog shown in Fig 40 This dialog offers several optimization methods for the figures The tool
122. er beam Please use points very carefully in Germany the prescription a minimal height of 2 70m for laser beams which exceeds the maximum allowed irradiance The program will generate automatically three points Two are invisible blanked and one is visible Via a right mouse click the tool lets you adjust the number of repeated points for a beam LI a Rectangle This tool is used to create rectangular tunnels within the laser show thus squared tunnels are included The four sides can be colored as desired 20 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start ke Polygon This tool is used to create polygon tunnels with plane sides By a click with the right mouse key the number of corners can be changed A polygon with very much corners will create a circle again naturally A polygon with four corners will give a rectangle three corners will give a triangle The sides of the polygon can be colored separately N Line This tool is used to create laser planes in your show The line is generated with blanked points at start and end Bi Freehand This tool is used to draw freehand figures Automatically blanked points at start and end will be set Here some parameters can be adjusted by a click with the right mouse button on the icon Al Text This tool is used to create texts Please read the respective chapter below for more information is Bezier Tool is used to create curves and Be
123. ers Optimize Output R ettings Output Colour Correction Midi DMs Hardware Opt 2 2 a 550 550 500 180 5 5 Export Settings Import Settings mize Output H w Estra Colour Foint at Line Start Hardware 1 Virtual Device f Extra Colour Point at Line End Copy optimicesettings to aff Comer Point Repetition I Picture Center after every Frame 4 f Maz Distance Laser Off oe t PPS iz Max Distance Laser On i B Frame Start Point Repetition 0 H Soft Colour Distance i B Frame End Point Aepetition Ql H Max Point Distance Text af so Colour Shitt F iy Movement if output is Off dark picture because of safety ff Colourshit G Line 4 30000 F 4f gt Colour Shitt 8 9 Urals 2 Fig 26 Dialog Options Qutput H ardware Close Window The Effects Window is used to apply the basic settings of the effects to a figure and partly to set some optimization methods Effekts Fenster Auto Boot Always same Absolut Value start direction m Value Start Value Effect Value 4 Reset b 4 gt Reset 4 gt Reset 4 Reset 4 b 4 4 4 gt Reset 4 gt Reset 4 gt Reset 4 gt Reset 4 gt Reset 4 gt Reset 4 gt Reset 4 b 4 b 4 b Size 4 r V Rotation 4 Compression x 4 Compression Y 4 wii TH CER CE Iv Iv Iv Iv Iv Iv Iv p v Iv Iv Iv v Reset 4 Reset Reset Intensity A Intensity G Intensity B Comp Axis gt
124. es not monitor the intensities of the lasers then it will interrupt the output if the scanners do not move This can be the case in short pauses of the show which are wanted no scanner movement To prevent in these cases the shutdown of the system by the safety the option of scanner movement without output is necessary Here you can adjust the movement of the scanners to prevent the safety shutdown You can select a point as figure when a beam zone can be adjusted for the safety a line or a circle The coordinates for the middle of the figure are entered into the boxes X and Y and the size radius into the textbox R Allowed values are in the range of 32767 only positive values for circles On the other hand sometimes it is necessary a partly suppression of standby beams during the show A standby beam output of a laser in spite of zero signal will become invisible more or less when the scanner is moving 5 3 5 1 Adjustment of the PPS Rate Instructions To find out the ideal scan speed can be a tricky thing The scan speed in PPS of a galvo system according ILDA has not stringently to do anything with the optimal display of a show That value is valid only for 8 degree Mostly the scan angle is much greater up to 60 degree and more Tip is the following 101 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor e Set the scan speed to about 50 of the nominal value for the Galvo
125. esinansawannvsnmesnesaswicnsanieusnaseaaplaxeuseua ndebseuntoesntncioaniadrmieents 135 5 9 DMA CON sisson dee tiers tacee aira 136 TAS Jee eect pets ate wart te e nctesatnean os cane tiaonaanee at omeauleeraetenntoaee 137 OO LLRI NOCO CDS eatcae ectgm accnies tain toed e 138 2 161 00066470 DOC Version 1 0 EUROLITE HE Content 9 5 1 2 Region Edit SIEDS erson e AEAEE EE N REEE EE EREEREER AERE ENERE 139 Ieo ROON FIIO seser eR E E E eee E 139 5 5 1 4 Additional Elements Output Master Mapper etc cccccseceseeeeeeeeeeees 139 552 CS ITI cerina a te ecancamtad Gy aoeuniactetiediuautanetcds 141 5 5 2 1 Button Edit DMX Device siicieiecatenicriccesistspert coerce rains deurhotaerawidinaetatoiiGatccueannataenmxisenees 141 5 5 2 2 Button Use DMX DeVICE 7 eceeecececececeeeeeeeeeeceseneneeeeeseseeeeaeaenenenenens 143 5 5 2 3 Selection of the DMX Devices to Create Macros cccccecceceeceseeeeseeeeeeees 144 5 5 2 4 Button Save Device List eee ceceecece ec ececeeeececeeeeeeceeeeeeeeceeeeaeaeeneaeananeees 144 5 5 2 5 Button Load Device LS siviwsscetccncusctenandanendeacuearectnsdoasaund akiuteaweriudediuerdeursbedws 144 5 5 2 6 Button Clear Device LiSt n nnanannnnennnnnnnnnnnennernrnnrnrrrrnrnrrnrnrnrnnrrrrrrerrrrnrnn 144 5 5 2 7 Use of Intelligent DMX Devices ccc ccccccccceeeceseeeeeeteeeseaeesegeeseeeseeeeaaeees 144 5 5 2 8 Intelligent DMX and USB Dongle c ccc cceccceccceeccceeeeeeeeceee
126. ey pushed for example when the intensities of the red green and blue Me Edt Tools Settings Playlist Infott Countdown lasers should be recorded ee aL eei simultaneously Recording on multiple K tracks is only possible for effect tracks Then push the red button to record the show red arrow in Fig 23 Now the music is playing the laser output or the simulation is active and you can arrow for recording marked track enter the changes of figures via the assigned keys or the effects by use of the mouse 5 i lt 5r a eee oe H Wisplacement s Fig 23 Direct recording of laser shows Red arrow To show the figure only as long as the assigned key is pushed it is necessary to select the item Use key up event gt figure off in the Show Editor menu Settings Otherwise the figure remains active until the next is called or the key figure off is pushed The standard key for figure off no figure is the Space key The place time where to start the recording can be determined by clicking the Timeline green arrow in Fig 23 When wav music files are used the loudness of the music is displayed there The laser show should be saved from time to time e g when you have done important recordings For this use Save Show in the above shown menu File If no name for the show has been given yet a dialog to enter the name is opened Hin
127. figure vector graphics is shown But this is not the final number of points of the laser figure In the Fig 6 you can see 2276 points for the Beamy that are really too many points to get a flickering free projection with standard Galvos lt 30kpps The final number of points will be more than the calculated 2276 because the final figure will contain also interpolation points and corner repetitions For 30kpps galvos a limit of 2000 points in total should not bee exceeded to get a flickering free laser display The number of trace points can be controlled via the four scrollbars to the right more points to the left less points The aim is to find out the smallest number of points which will nevertheless give a good and flickering free laser display of the logo A generally valid procedure for all masters is hardly to give The converting of a master into a laser figure is surely dependant on the complexity of the master possibly the example of the beamy is not the best Simple logos should work well for the conversion You should remember Every corner needs a number of points every curve needs more points Too many points will lead to a flickering laser display The masters should have a width of about 800 pixels It will make sense to simplify the master with image processing software convert to gray values delete obsolete elements If the converted result shown in the lower black window is satisfying then click
128. frames will be created If you accept the created figure then a warning will be displayed too if necessary What are integer multiples In the strict sense we have to deal with the smallest common multiple Example Look at the numbers 2 and 4 4 is a multiple of 2 because 2 2 4 Thus the smallest common multiple of 2 and 4 is 4 1x4 4 and 2x2 4 Next example Look at the numbers 2 and 5 5 is not an integer multiple of 2 Because 2 2 4 and 2 3 6 The smallest common multiple of 2 and 5 is 10 because 2x5 10 and 5x2 10 That all seems to be simple but now let us look at combinations of three numbers which are taken by chance e g 1111 1134 and 3241 The program knows the answer because it is calculating Clearly we can say that e g the numbers 1000 1500 and 3000 will fit very well together With that combination the program will create 30 frames the 0 can be omitted 3x10 equals 30 2x15 equals 30 and also 1x30 equals 30 too With a little training you will find out quick fitting numbers and you will create beautiful waves You do not need to calculate just pay attention to the warning Problem 2 Not really a problem more a hint If a rectangle is used for one wave and the vertical sides shall be dark then it is advantageous to use the last used generator for this The software recognizes the setup and the edges will be blanked If after the rectangular wave a color signal is added with a further generator th
129. function fills breaks in the course of the effect Times are selected where the effect value changes by one unit f Hence more steadily effect courses are created gt Apply This button closes the window and writes the edited effects a into the respective subtrack Push the button Undo to restore the old state lsayGoodbye m1 heb 9 4 1 5 Button Info Bb 245 This button opens a small window to show the figure Spur F 1 and its name Fig 95 when you click its position in its Fig 95 Show Editor Info subtrack If you have multiframe figures which have dark frames in the beginning then it is useful to open the simulation window too 116 161 00066470 DOC Version 1 0 EUROLITE HE show Editor You can use the info function by moving the cursor with pushed mouse button within the subtrack If you use the right mouse button then the events of all figure tracks which are active at the respective time will be displayed displayed means the display of the information within the info window and the output with the laser projector if switched on The laser output will be activated and also finished automatically Because very much information is to handle please move the mouse slowly 5 4 1 6 Buttons Cut Copy and Paste Cut These functions should be self explanatory With Cut marked events are copied into the clipboard and deleted in the subtrack With Copy the marked events are copied into the clip
130. g h DH input offset Setup Midi input routing OMe Input Routing Fig 6 Menu Options MIDI DMxX Selection of DMX ports for input and output selection of MIDI device and setup of printer For DMX it is possible to choose different cards for input and output The duration of the request interval for the input can be adjusted too depending on the laser output See for more information chapter 5 3 3 Index Card MIDI DMX Here are some additional comments regarding the different hardware types 3 3 8 DMX gt EasyLase NetLase and Lumax The EasyLase DMX hardware has one input and one output port Thus this card can be driven by the software like a real DMX device The DMX input serves for the control of EUROLITE HE with a DMX controller like a DMX device The DMX output is used to control the figures and effects with EUROLITE HE via its Timeline This is useful for the creation of shows or for the control of effects in the live situation The DMX input of the EasyLase II makes some problems For those who want to use the DMX input it is recommended to take the EasyLase I the Lumax or the NetLase gt DMX4all USB Dongle www dmx4all de This DMX interface is not supported by EUROLITE HE gt MLD Devices with DMX This hardware is not supported 13 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 9 TTL Switches The TTL outputs of EasyLase DAC the NetLase version 4 and Lumax DAC are supported by EUROLIT
131. g the laser show writers some conventions are already discussed and accepted Here are only the most important ones cited 8 1 1 Beam Zone and Audience Zone Bad beams single still standing and bright beams should only be used above the middle line of the frame in Germany the minimal height for these beams is 2 70m when they are parallel or increasing in height this should be the middle line In other words The middle line should always be above the heads of the audience This way no glare by very intensive beams can be present If this convention is not fulfilled it should always be remarked within the info txt file Nevertheless it is always recommended to display unknown shows at first on a wall or screen to prevent unhappy accidents 8 1 2 Assignment of tracks to projectors There is no fixed assignment of tracks to projectors existent In general it is common use that track page B is used for satellites small additional projectors Also track page D is generally used for graphics Exceptions are allowed of course but should be remarked within the info txt 8 2 Terms and Names There are many terms and names used to describe different things Thus there may be confusion especially when other programs use the same term for another use Example At EUROLITE HE there are figures which represent a file and also consist of frames single pictures With other programs frames also exist but mean so
132. g tools for marked points of the figure buttons to select the kind of painting function line circle etc and buttons to save the created or edited figures Below the buttons for saving you will find the textbox to enter the width of the grid in the painting window In the upper part of the Figure Editor is the Menu Bar here you can reach additional functions which cannot be called with buttons On the right hand of the window you can select the desired color for the painting by help of the Color Cube Color Circle or the palette of the favorite colors 2 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Below the Color Cube you can find buttons to reach other windows Window Selection Here you can also find buttons to set the laser output to ON or OFF to use the Simulation instead of laser output and to set the screen to black to increase the output speed Below that you have a button for complete Reset and one for the Assignment of figures to keys also accessible via a right mouse button click to the respective figure Below these buttons the Folder Window is situated Here you can select the folder to store load the figures for editing When a whole laser show is loaded via menu or Show Editor the respective show folder is shown here On the right hand in Fig 32 you can find the Figure Table with the list of the already created figures In the lower part on the left side is a region where Inf
133. hat needs some time This delay could possibly be noticed at the start of a show Dependant on the speed of the graphics board it may be necessary to increase the value for the delay of the start of the show Showeditor menu Settings ATTENTION As soon as the mouse is moved or the mouse itself is moving the monitors will be reactivated That can additionally cause heavy bucking of the laser show Hence the third option Deactivate Mouse and Keyboard was built in But this has the consequence that you can not stop the show You have to wait until the show is finished Tip Move the cursor just above the PlayHQ button lift the mouse push the button and then put the mouse upside down onto the table This trick works well with an optical mouse Unfortunately the LED of the mouse illuminates the room If you own a notebook then use the touchpad to avoid all problems gt Save Undo Files If this option is deactivated the undo files are no more stored The advantage could be an increase of the speed of the program especially if big ILDA files are edited Disadvantage In case of a program crash the recovery will not be possible gt Select Standard Folders Here the setup of default folders to store the different data is done If the respective program dialog is opened then these paths are used as default gt Define Autoload Show Here it is possible to select a show which is automatically loaded on program start gt Reset Auto
134. he figures developed with them can not be saved on the harddisk Full Version To access the full software package connect the USB interface to your computer Then all options are enabled Up to 16 output cards DACs can be used controlled via twelve figure tracks including the corresponding effect tracks Furthermore with the full version the intelligent DMX controller can be used Shows may also be protected against unauthorized access 3 2 Updates There will be no updates for EUROLITE HE but entirely new versions Prior to installing a new version the old version must be removed from the computer beforehand To do so start the file Eurolite HE_V msil select the option Remove Eurolite _HE_V in the following dialog After confirming with Finish the old program will be removed The ini file remains in the Windows folder Thus all settings will be kept Series number hardware setup etc Now the update can be carried out like a new installation In case of bigger problems the old program folder and possibly the ini file should be removed beforehand An exact location where the ini file is stored can not be given as the location depends operating system settings since the introduction of Windows 7 Thus the option to delete the old ini file via the program can be found under Options Reset To determine the location of the file use Options Others Button Show software Paths Normally it is not necessary to
135. he problem arises when at the creation of the show no attention is paid to this option Then it could happen that the option is not activated This may not be noticed because at home the size of the display has possibly been reduced via Size of Show Options Output An effect like Displacement then has much place to push elements outwards on the sides The elements remain visible when the Global Size the scan area is not exceeded But later at the Lasaerfreak Award the situation was different The room was really wide and thus the Show Size was set to almost 95 Due to that already smallest displacements pushed the elements out of the scan area and they then were invisible but they should be visible That was aggravating because elements of the show disappeared 88 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Meanwhile the structure of the software was changed due to those problems The option Margin Visible now is set as default and has to be changed by the user if wanted If the option is not activated then this will still be valid when new figures are created The option must be activated again for new figures The default will be restored at every start of the program The settings of the effects are not stored any more The option Use Soft Color will activate a smooth transition from one color to the next The settings at Options Optimize Output Soft Color Distance will be used for the fading
136. he respective show which is currently loaded They are stored into the show file shw and thus can be different for the shows gt Laser output without effects and optimizing for ILDA file Load the show Open the Effects Dialog of the respective figure Remove the check at the option Optimize Corners Save the file Now the show should run normally again REMARK only for information Because the number of points of an ILDA file is much greater then in a EUROLITE HE file heb it makes no sense to export a show 92 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor as ILDA file and afterwards import it again for better performance Original HE shows will run better than imported ones But nevertheless it makes in another way sense Shows with multiple tracks can be converted to single track shows which then can be played with the freeware version too In the upper part of this manual has been explained why the output has to be optimized for the galvos ILDA files have now a perfidy On the export of a show into the ILDA format all information about corner points and distances are lost the state of the points Thus ILDA files are exported usually in that way that the optimizations are contained within the ILDA file That means the corner points will be repeated and distances are interpolated If now the ILDA file is imported then it will logically contain many points but the information about the kind of points is lo
137. he scroll bar on the right side EITI i For the Color Circle the scrollbar is used to adjust the ai saturation gt Views of the Color Cube The directions of viewing the Color Cube can be changed via the three radio buttons on the left near Color xxxx This does not change the colors only the view of the cube gt Favorite Colors Below the Color Cube or Circle respectively there are Colour 4095 Colour 4095 listed some of the mostly used bright colors To add vO OeMNGGEnGGe HON TIT your favorite colors use drag and drop to put these into Fig 46 Color Circle the free places gt Selected Color The currently selected color is displayed together with its number below the color cube 5 2 9 Checkbox Figures Always on Top lf this checkbox is checked Fig 47 then the Figure Table will be always on top in the foreground This is useful for e g the Show Editor when figures shall be put to a track by drag and drop The box will be unchecked when you uncheck it or when you double click the black background of the Figure Table do not hit a figure The opening of different other windows can eventually uncheck it Options DMX etc The setting of this option is stored within the ini file Thus at a new start of the software the same setting is restored Figures Always on Top Fig 47 Figure Editor Checkbox Figures Always on Top 55 161 00066470 DOC Version 1 0 EUR
138. how Blanked Lines f Intensity Brightest Colour amp Intensity Grey Scale 30000 34575 213 Fig 87 Dialog Options index card Color Correction The Color Correction dialog serves for different functions The existent lasers can be defined and their brightness can be adjusted to get correct color mixtures white balance only possible with analog driven lasers The Color Correction is done separately for each projector If some lasers are not present e g the blue one then the respective colored parts of the figures will be displayed by the existent lasers mapping Furthermore safety zones can be defined gt Show Blanked Lines This option is thought as a help for the set up of the correct values If chosen the in general blanked movements of the galvo mirrors are displayed To distinguish them from normal lines un blanked they are colored RGB in small parts a small piece of the line is red the next green then blue to estimate the distances if you have only a green laser then the blanked lines will be displayed green black Attention If a figure consists of O points currently no figure a still standing beam will be projected A message will be displayed to warn you gt Intensity Brightest Color Intensity Gray Scale This option lets you chose how the level of the intensity signal is calculated It is only of interest for se eee ae users which use the intensity signal of the DAC to Laser
139. ia a double click within the Windows Explorer Then EUROLITE HE s automatic player is opened automatically with the respective setup gt Joystick Wii Once there was the idea to control the laser figures with the Wii control That worked partly with two virtual joysticks If you want you can try to instal two virtual joysticks and to play with them no guarantee is assumed for the functionality 70 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt Beatcounter The eatcounter helps to determine the beats per minute bpm of a song As you know from above you can adjust the FPS as BPM value for the speed to play animations amp GeatCounter 27 Beats Iof x 0o r 392535011312 When you select this menu item a dialog to count the beat will open Fig 65 You can also open the dialog in the Show Editor via the menu Tools When you have loaded a song in the Show Editor Play Song via New Show a click Play Song will start to E play the song After pushing any key except the Rip G5 Becicouniers D AO space key or after a click with the right mouse pears see also Show Editor Tools button on the black window a reset of the beat count is done Now click with the mouse on the black window in the rhythm of the song The clicks are counted Above the window the currently calculated bpm rate is shown On the right you can see a red bar above or below a black line When the bar is above
140. iew is generated in the Show Editors Timeline Just after the selection of the audio file please click Play button with green arrow in the Show Editor to verify its correct function Now the creation of a show can be started Two different methods to do it are available 27 161 Quick Start Window Live Window Fig 20 Buttons of the Menu Window w Show boitorEvents 1 Fie Edit Tools Settings Play Create New Show Open Show Save Show Save as Clear Timeline Export Show as ILDA File Create Show trom ILDA File Show Dongle Protection Das Gold_der_Inkas pll Fig 21 Menu File of the Show Editor 00066470 DOC Version 1 0 EUROLITE HE Quick Start Method 1 Drag and drop Via this method the figures are just dragged picked up from the Figure Table and dropped put into the tracks of the Show Editor Placing a figure via drag and drop and movements of the events it is not possible to create a music synchronous show easily Via this method the figures are selected within the Figure Table by mouse click then the left mouse button is hold pushed and the figure is moved into the desired figure track On releasing the mouse button the figure is inserted into the track To get the calling of the figure music synchronous additional movements will certainly be necessary Functions of the Show Editor like Grid and Zoom will help to place the figures exactly It is now possi
141. ing To create a show part click New Show Part choose the music and the record the events for the wanted show part For this all effects and figure tracks can be used If the creation of the show part is finished click menu Show part gt Aus Sequenz erzeugen Create from sequence By doing this the show part is saved within the Figure Table as figure The Show Editor will return to the current show In the Figure Table you can see a figure with yellow design That is the show part The icon can now be edited by a click with the right mouse button Select Edit Show part Icon to insert a picture for display the picture must be created with another program The show part can be edited too by a right mouse button click The program will open the Show Editor automatically to edit the show part After editing the changes must be accepted by menu gt Show part gt Apply Remember to store the show part figure by clicking Save with the button of the Figure Editor The current show will be buffered RAM Thus do not switch off the computer else the edited show could be lost The careful reader will notice that this chapter is just a copy of the above description Show Editor Menu File It was inserted here additionally for a fast access and for the reason to find the keyword Show Part within the content 2 161 00066470 DOC Version 1 0 EUROLITE HE Hints 8 Hints 8 1 Conventions Amon
142. ings to t Displacement 3 4 Celling height limit Displacement r t Rotation Size of Show ae linked sr linked t Size 4 t Size x t Size 4 t Size t Trapezoid t Trapezoid 7 t Pro Distance a h l a kill Fig 86 Dialog Options index card Output These options are used to adapt the projector output to the environment and to manipulate the scanner and laser output Concerning the size of the projections two different regions are available One is used to set up the global size and one for the show size The difference will be explained below Output hardware Via the list box the projector is selected for which the settings are valid Mirror X Y Check these options to mirror the x axis or y axis output Swap X Y Via this option the output for the x axis is done at the y axis and inversely Displacement X Y Via these scrollbars the whole output is displaced on the directions X and Y Naturally it is a precondition that the scan region of the galvos is sufficiently extended If global size and show size are already set to their maximum then a displacement will hardly be possible because the galvos will come to their limits or in other words the range of 16 bit coordinates is fully exploited Important The default values of the respective scrollbar are recovered by clicking the respective caption Rotation Here a rotation of the output can be adjusted to get it h
143. int below the middle line of the painting window because the resulting beam will go into the audience The program will set the following points automatically blanked point to reach the position visible point s at the position and blanked point at last To show the points in the painting window it is necessary to set the option show points in the menu Edit If the option blanking visible is set within the options dialog the colored points are eventually not visible because they could be overlapped by invisible ones A Text tool This button will make it possible to create texts Different options for the design of text are available Depending on the desired animation or design of the text different procedures for the creation have to be used Simple words and signs not animated To use this kind of design the text option Morphing Text has to be selected To open the dialog for the text options click onto the tool with the right mouse button In the dialog choose the option Morphing Text Furthermore you can set here the font the quality and the size of the letters Enter a longer text into this box without word 10 Pal gi E Qualy Pon Distance AN Al eqn Ke aww i ET Ye Ei Scroll tep GMingLil_HKSCS EntE Minglil ExtB GMS Gothic EME Mincha nter a longer text into this bow without word wrapping The text will be spit into several frames
144. is menu item opens the playlist Play List Info tet L See next chapter for explanations l Display gt Save cave Saves the currently loaded playlist coed start Flay List gt Load This menu item opens a present playlist Fig 109 Show Editor Menu Playlist gt Start Playlist This menu item starts the playback of the shows of the playlist Playlist i x K gt New List V Loop r Runaway shw Routing Load V All shows Close Window Save P Wait before start next show Output Routing Create Playlist from folder A B C D a Hardware 1 Mvo fF W 2700 ici Haims OP sto oe Hardware 3 JT Vv Ww fF 2500 Krid_P_BackPipes shw Hardware 4 fico MesseFrankfurt_2008_ Show shw Ss 8 5 ue Mika_Grace_Kelly shw Hardware 5 ii i in 10000 MOAB_Soul_Essay shw Liquido shw Hardware 6 S fF fF fF fioooo Amore_Per_Sempre shw Nightwish_Hochzeitsshow shw Hardware 7 mn go 10000 Pianosong_Show2_2 shw RockKlassikT echnoMix shy Hardware 8 a S gf 10000 oe Hasses C C C C fm Sequenz shw Hardware 10 Pr F F fF 10000 SongOflndiference shw Foe SummerOF96 shw Hard 11 Midi info Terminator shw aa m m j a Ub Hardware 12 i i in 10000 einer Hardware 13 i i 10000 Hardware 14 C rO T Ff f0 Hardware 15 O i in 10000 Hardware 16 ia i in 10000 Dissable Messages Fig 110 Show Editor Menu Play List Display opens the Playlist 9 4 2 8 The Playlist The playlist depends on the path of the file
145. is possible to set the show size to higher values But when the show size is set to 100 too then displacement effects will have no more place when the figures 105 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor use the totally possible scan region According to the setting of Margin visible in the effects dialog the lines crossing the border of the scan region will become invisible or they become visible but compressed on the border To set up both scroll bars the following procedure is recommended 1 In the first step it is recommended to project the figure Orientierung_Test heb folder HE_Testbilder If this figure is projected with wrong orientation then Mirror X Y will help to correct this To set up now the sizes create a square with 100 size set the size effect to 100 An already existing figure to use you can find also in the folder HE_Testbilder named RasterBild heb Now the laser output of the figure is started Then open the dialog Options Output Set the show size to maximum Now adjust the global size The figure shall be visible within the whole wanted output region screen If the figure has a suitable size but is not projected fully onto the screen then use the displacement X Y options The output region for beam shows can be quite more extended than the region occupied by the audience Furthermore for beam shows it should be secured that the center of
146. ith the software with the help of that DLL HINT NetLase is currently the DAC with the best performance Unfortunately the price is considerably higher than that for the Lumax or EasyLase but this is logically based on the features The NetLase is also available as 6 channel version and includes an ILDA file player which can be used in stand alone mode without a computer Once you start using 10 DAC you will quickly admire the benefits of the NetLase Switch and projectors with NetLase on the stage only one single cable form computer to the stage is necessary instead of 10 ILDA cables 3 5 4 Lumax MiniLumax www lumax de The Mini Lumax works properly and currently has a big advantage meanwhile a 6 channel output is available The new card has 5 1 color channels These are the outputs for R G B Mg Ye and Int But thanks to the effective setup possibilities via the test program the channels can be routed user defined Thus the Lumax card can drive more than 3 lasers even if the program delivers only RGB values Because today also laser diodes at 405nm and also 440nm with 100mW to 200mW power are achievable for small money a 4 color system is quite interesting The Lumax DAC will provide good laser projections when the drivers for Windows are installed correctly It has DMX inputs and outputs and additionally TTL switches After the first program start select Lumax from the hardware list EUROLITE HE supports up to sixteen Lu
147. ith the TTL option also danger is present Assume a tunnel which becomes smaller until it shrinks to a single beam Thus the show programer will dim the lasers when the tunnel becomes smaller But this dimming will not happen with a TTL modulated laser a dangerous beam will appear which is much too bright 110 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Thus it is not recommended to use TTL modulated lasers gt Window Projector Brightness Audience Zone Here it is possible to define in the graphics window the zone where the audience is expected You can draw the zones where the intensity should be reduced with clicked mouse in the window With the scrollbar the overall intensity for these zones is adjusted Global Brightness Here the laser intensity can be adjusted globally If you set it to 70 of maximal intensity and also at the audience zone then the intensity in the audience zone will be only about 50 of the maximal possible intensity The 100 reference for the audience zone is the value at Global Brightness 5 3 9 Index Card Reset Settings TEER aE pe E GEER ee Optimize Output Hardware Text Show Output Colour Correction Others Midir DM Reset Settings Reset only Window Positions Fig 90 Dialog Options Reset Settings With the help of this dialog all settings can be reset to default values button Reset Settings Furthermore a reset
148. ithin this dialog you can select the DMX channels one after another to look at their respective assignment on the left side of the window Fig 129 Lasertrack number O channel The assignment of channels behaves exactly as for DMX the track order in the Show Editor from bottom to top Thus the first channel referring to DMX input offset is the subtrack O Figure Fig 129 the second channel is the subtrack 0 size and so on in total 19 channels per track are available in which DMX out is not supported To control all possible channels your DMX control thus needs exactly 12x19 228 channels lf someone is interested in the logical description the following is necessary to understand Important is to understand the definition Laser Track The Laser Track Number is that number which is written at the tracks within the Show Editor see Fig 129 It runs from O to 11 thus we have in total 12 Laser Tracks Unfortunately this is sometimes somewhat confusing because there are depending on the software different names in use for that Laser Track Track Number Track Channel German Spur and more Excuse this chaos it is sometimes not easy to have a common defined name for the same thing Let us now define Laser Track we have 12 see above Each Track has 19 Subtracks Figure Size Rotation see Figures 129 and 130 left side Each of the
149. ity is to let create longer text automatically up to a full DIN A4 page Then the text will be divided into sections and a number of frames are generated The settings for the creation of automatic text are done in the index card Text of the Options They are valid for the SMS to Laser text too The global settings like font and size are done during the entering of text The possible settings are gt Max Number of Signs The program tries to find a space sign starting at the end when generating the text in Fig 81 there is entered the value 18 this means that the program starts at letter 18 while going forward to find the space sign At that point a new frame will be created A bigger value for the Max Number of Signs results in a greater variety for the possibilities of the page break If no space sign is found then the text will be truncated at the sign with number X e g 18 and the next frame will be generated The software operates on the generation of text in the way that automatic morphing is possible between the frames For this a request will appear gt Use Compression x y Absolute The entered x y value will be applied to the effects window for the generation of text effects With this option the text can be mirrored automatically e g to see it from 91 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor both sides of a screen The same is valid for the y value e g over head pr
150. ize RGB 5 2 12 3 Menu Edit This is a special tool to change the color of several points Of Edit Figure Assignment Fi one color or to change the color of points with the same toes color in a series of frames It works in the following way 1 Mark all Points 1 Select the future color of the points please see chapter Color Selection E one 2 Mark one of the points of the figure to redeye w Show Points perhaps you need first to mark Show Points to Show Blanked Lines make single points visible v oe fs ew gid gt Fig 56 Menu Edit 62 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 3 Now click Color change A dialog to set the options is shown see Fig 5 7 Please make your choice and finish with a click on Do If Color of currently selected point or Destination color are not satisfactory please click Cancel and select the correct colors i Colorchange Vel Do Cancel Colorchange options Frames election f Change only actually frame a a a r C Change all frames C Ekhange ony pamte aiti the zame calar ot the actual selected paimt a Color of actually selected point Destination color selected in figure editor Fig 57 Menu Edit Color change Dialog to change colors of points gt Mark all Points This menu allows to mark all points of the current frame After clicking it all functions like copy cut paste and change color can be used
151. izontal scrollbar is used Above the scrollbars the boxes are all colored red when Create New DMX Macro has been pushed The color red indicates not jet used controls for the currently edited macro It is important to understand the color code The red color means that these channels have not been defined SO File Edit Operating Made far for the currently processed macro All red marked channels will not change the value of the respective DMX channel on calling the macro If a scrollbar is adjusted the red box will change to green color and the currently adjusted DMX value will be displayed The activation or deactivation of channels via green or red flags respectively is a useful visualization to prevent unwanted actions of the macros Let us presume that channel 6 and channel 7 refer to two lamps which can be dimmed and channel 8 and 9 refer to a RGB color changer Then this macro which we see in Fig 118 will have no influence on the RGB color changer because its channels are still red If an activation of the RGB color changer is wanted too then the respective scrollbars have to be adjusted at least once At least the created macro can be saved via a click the button Save Remember When the box above a channel is red then it has no influence Fig 118 DMX Editor Used and unused channels 137 161 00066470 DOC Version 1 0 FT F F F F Fl rl ri s 1 2 3 4 i lb f jp io j1 BR eRe B
152. k it is possible to collect all tools for the live show and then store the collection as Live Show file with extension live Everything that belongs to the show figures assignments the show itself has to be stored within a show folder The Live Window has this design o Fie Controller Assignement Show optio Taste Z Optionen E E Use Key Re n ma bd Me i i v V Output Traci Swich off u utput Track 1 DMX ssignemen lt ul ck 2 MX Start Yal ae ale Automatic Mode 2 tart value z i Jutp ck3 E indow on to op Value Output Track 5 ave live sho s idi Mappin J j a a Gest eee cise wo os j j fi H H y Fig 136 The Live Window If the screen resolution is less than 1280x1024 pixels some scrollbars for the effects could be missing More information fill follow below The idea of the window is the following The live show shall be controlled via pushing keys or by mouse clicks or DMX If a key is pushed then the assigned laser figure or animation shall be displayed by one or more projectors The principle of a live show is the following For each key the respective settings are stored These can be 2 161 00066470 DOC Version 1 0 EUROLITE HE Live Window for example the laser track number on which the figure is put out the behavior of the other tracks which are not used and more Therefore in the upper region of the window are different possibili
153. ked then also the blanked points are pushed through the property invisible is regarded as color and pushed through the figure e All frames of figure This is an option which makes the pushing through of colors very interesting If the option is chosen two things will happen with multiframe figures 1 The colors of the first frame are pushed through all points in several frames 2 The coordinates of the points will be taken from the existing frames of the figure Perhaps it is more complicated to explain this then to test it Thus please be brave and test it Hint Assume to have a multiframe figure Each frame consists of 2 colored points which have another position from frame to frame The first frame shall be red and blue the next blue and green and the following green and red If now Push Trough 84 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Colors is applied then all new created frames will be red and blue because only the colors of the first frame are pushed through Furthermore only two frames would be necessary to apply the tool for two colors but the animation consists of three frames Thus the software will calculate the smallest common number of 2 colors and 3 frames and hence will create 6 frames 5 2 13 6 Insert Color Gradient Insert Smooth Color This function basically does the same as the option Use Soft Color of the Effects Window what is done in real tim
154. l After the click the menu item just follow the instructions HINT It makes sense to have 25 to 50 frames per second even if the later used galvo system is not able to put them out For short tests smaller frame rates can be used The software exports and imports only ILDA Shows with constant frame rates Shows with a constant PPS rate can not be exported The import of such files is 122 161 00066470 DOC Version 1 0 7 EUROLITE HE Show Editor nevertheless possible but makes no sense because the temporal coherence with the song will be lost The export should be tested a little bit by varying the optimization and output setups It makes absolutely sense to create an extra ini file only for export purposes For the export as ILDA file please set the show size to about 2 3 of the global size and select only one hardware routed to all pages No color correction should be used reset A PPS rate of 30000 is recommended and no color shifts shall be set important for the optimization The following settings can be used for an ILDA export for other programs They were used at the Freak O Jam 2008 and worked very well Output Pay attention to Showgr e it should be about 2 3 or a little bit ore The rest is standard Otherwise to get standard default values please click the captions of the scrollbars Important Do not use mirroring or similar things Optionen Text i Show Mid OMe Drucker Sonstige Ausgabe Optimieru
155. l can be controlled via MIDI or DMX Presumably the control of the software by external controllers is referred to the Live Window You have to realize the following valid for the whole software 1 Figures are always assigned to keys of the PC keyboard 2 The keys can be linked to MIDI or DMX values If a key is pushed by anything can be the Timeline the PC keyboard a MIDI or DMX command whatever then the respective assigned figure is activated 2101 Live window Timeline 3 Midi Channel Show Midi monitor Message Mo fad Data value as condition i Datal f Data Value fo Use value from i Datal C Datae Save Midi assignement Load Midi assignement Reset Midi assignement Fig 132 Live Window MIDI Input routing assignment for Live Window 150 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor iol x Live window Timeline 3 Midi Channel Figure Size Rotation Compression s Compression r Intensity A Intensity G Intensity B Comp Asis Comp Axis t Fotation Center Rotation Center r Displacerment s Displacement r Frame M umber Rotation 2 Rotation 2 7 Rotation 2 2 Fl Fl2 Intensity RGB Function Select output track select event track figure or effect and choose which midi values should change this track Save Midi assignemernt Load Midi assignement Reset Midi assignement Show Midi monitor Add new assignment Zuord
156. l open standard Windows dialog for saving Fig 42 File save buttons and grid gt Save As will open the standard Windows dialog for saving The use of this button enables you to save copies of the figure with different names or to save the changed figure with another name gt Save All will save all figures of the Figure Table So you can work on several figures and then save them with one click Hint on special characters within file and path names Because this software is used internationally and thus also in countries where no special characters like a 0 etc are used it is not allowed to use them for the file or path names If this restriction is not followed a message is displayed Furthermore it is not allowed to use empty spaces within the names 5 2 6 Textbox This textbox see Fig 42 is used to change the grid of the Painting Window Smaller numbers will give a smaller distance of the grid lines Accepted values are 1 to 300 The smallest possible value is 1 no grid because the program internally uses integer variables Sometimes it will be necessary to set the grid to 1 to reach otherwise unreachable points 5 2 Output Path Within the Figure Editor it is possible to determine the hardware to put out the figures which are fe loaded into the painting window The respective DAC must be selected via Options Hardware see Fig 44 This function is not intended for live shows t
157. lay HQ More information can be found there gt Enter Delay for Show Start Also accessible via the button Play HQ by a right mouse click More information can be found there 5 4 2 6 Menu Video gt Window On Off video By clicking this item the Video Window is displayed kidean Ra e That makes only sense if a video file is selected as Window Oni aFF media file for the show Correct Aspect Ratio All videos should work which can be played with the armide Inset wines Windows Media Player Usually the Video Window Full screen is Opened automatically on loading a respective Fig 108 Show Editor Menu Video media file A multiple screen system for the creation of laser shows with videos is perhaps a necessary thing gt Correct Aspect Ratio serves for a correct ratio of width to height of the video Eventually then the video will not fit onto the screen gt Stretch Video in Window Fits the video into the window Possibly the video display will be distorted gt Full screen Shows the video in full screen modus Via a mouse click the video will be displayed again in window modus 129 161 00066470 DOC Version 1 0 EUROLITE HE show Editor If the laser show is played via PlayHQ then the video window changes to full screen mode The main screen of the PC will be switched to dark as usual But for this the function Monitor Standby has to be switched off 5 4 2 Menu Playlist gt Display Th
158. layed here To record events the respective subtrack must be marked via a click its caption Marked tracks have a green background color 5 4 1 Buttons and Tools Within the Show Editor several buttons and tools are present for different operations Fig 93 TE Cut ii Redraw Copy SLAAI gt Effect ys Beara ee ae ee Lif 2 DMA Macro _ E ig 93 Show Editor Buttons and tools F 5 4 1 1 Magnifying Glass The magnifying glass is used to zoom parts of the Timeline This is very helpful to work on single events or small groups of them The magnifying glass works in the same way as that of the Figure editor First click the button of the tool If this is done with the left mouse button then the zoom is set to 100 On pushing the right mouse button the currently used zoom value is kept Now the mouse wheel can be used to zoom into the Timeline or with pushed left mouse button you can mark a region to be magnified The zooming can be done in several steps one after another A reset of the zoom is done via a click with the left mouse button onto the tool or via pushing the button Redraw Timeline with the right mouse button 5 4 1 2 Hand zA The hand has similar functions as that in the Figure Editor for marking or f moving the events With pushed left mouse button a region on a subtrack can be marked But only events of one subtrack can be marked That subtrack which is currently present in the center of th
159. le frames The respective frame number is displayed in the info box of the Figure Editor lower left corner gt Buttons for the Display Direction and a Cutting Tool With the three buttons to the right to the left and forward and backward the direction of display of the frames can be determined Via activation of the Loop button the frames are displayed as endless loop If the direction of display is selected as forward and backward then in the long run it could happen that the figure with a frame rate entered as bpm will not be simultaneous to the beat of the song because the first and the last frame will be put out twice on changing the direction The button on the left z activates a cutting tool This tool cuts a frame series at the position of the currently selected frame With its help a long ILDA animation can be divided into single figures for example The currently selected frame will be used as first frame of the rear part as well as of the front part 53 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 5 File Buttons Save Save As and Save All These buttons are used to save the created figure s Fig 42 gt Save will save the figure currently in work in the Painting Window If this figure is already named the prior existing one will be overwritten without warning If no name for the figure is present a dialog to give the figure a name and the path for the storage wil
160. les red arrows in the lower part of Fig 39 Additional points can be marked by holding the Strg key pushed To mark all points use the menu Edit Select all points in the upper menu bar Marked points can be moved by using of the right mouse button hold it pushed If no point is marked then the point just below the mouse cursor is moved when the right mouse button is used to move only one point Cut Copy Paste With these functions points already marked can be cut copied and or pasted Pasted points are marked and can immediately be moved with the hand tool If the marking is deleted before then two points will overlap what is not very convenient To copy or cut and paste a series of frames single pictures of a figure use the functions of the menu Frame Tools see below for more information Cut or copied points or frames can be pasted into other figures and frames too Sometimes this is very useful if animated figures are the aim of the creator Points pasted from the clipboard are always marked so they can be directly moved or rotated after pasting gt lt Rotation Tool With this tool marked points can be rotated The rotation center is the position where the mouse button is pushed within the Painting Window A horizontal movement with pushed mouse button results in a rotation with angle zero A movement downward means a 90 degree rotation upwards 90 degree rotation etc The rotation will be done wh
161. lete figure Or pull them Bidirectional M Use all frames of figure down make small in steps Vv increasing point numb T Line Out using increasin 9 point number Basically it is only possible to F Line In using decreasin point number F Line Out using decreasing point numb work on an existent and stored figure Fig 75 Extra Tools Stretch Lines Tool If you click the button Apply in the box Line Stretch for each line then all existent line parts will be drawn up simultaneously The value to enter in the textbox gives the number of steps which will be used to draw up the figure If you click the button Apply in the box Line Stretch for complete frame then the complete figure will be drawn step by step The value to enter in the textbox gives again the number of steps which will be used to draw up the figure If the option Bidirectional is checked then after the calculations of the pictures they will be added once more in the reverse direction the figure will become big and then small again The option use all frames of figure makes only sense if it is a multiframe figure animation If this option is checked then for each step the next frame of the source figure will be used For example with this you can slowly grow up a wave which naturally will swing It is advantageous to use the number of frames of the source figure as number of steps to draw up the figure too Otherwise some frames will be used
162. ling text Again the small dialog to enter the text will be opened Here it has to be remembered that existing elements will be preserved Thus it is possible to create scrolling texts together with other figures even multiple scrolling texts are possible with varying scrolling speeds 42 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor L gt Rectangle o This button will make it possible to draw polygons multi gt Polygon gt Ellipse corner figures This tool works like the ellipse tool The center of the rectangle is set by clicking the left mouse button Hold the mouse button pushed and pull the rectangle up to the desired size Ol This button will make it possible to draw polygons This tool works like the ellipse tool The center of the polygon is set with a click the left mouse button Hold the mouse button pushed and pull the polygon up to the desired size On releasing the button the dialog to enter the number of overlapping edges will open If the default value is accepted 2 overlaying polygons are created The advantage is that the polygons are closed everywhere and no differences in the intensity will appear If you intend to use the Morphing function later on it could be better to set the number of overlapping edges to zero The number of corners of the polygon can be set by clicking the right mouse button over the polygon button HINT The basic difference of a polygon compared to a circle is the m
163. load This resets the autoload of a show 97 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 3 5 Index Card Optimize Output Text Show Others Optimize Output T Reset Settings Output Colour Correction Midi Dhs Hardware Optimize Output 4 zz Extra Colour Point at Line Start Hardware Virtual Device x Ship ve Velie AT 4 H H Extra Colour Point at Line End Copy optimicesettings to SAT sterols Me E A Ce Ean Meren y Picture Center after every Frame B00 4 r Mas Distance Laser Off Sue B J E a an0 a a En f Hf H Frame Start Poaint A epetition s00 F l E e Witenes T aly H Frame End Point Repetition 180 4 r Mas Point Distance Text F a a i a Calour Shift F scanner Movement if output is OFF dark picture because of safety f Point y 3 t Colour Shift G C Line 30000 3 t Colour Shift B f Circle Fig 85 Dialog Options index card Optimize Output This index card is of most importance and influence for the performance of the laser output Here the galvo system can be set to its optimum but also the system could be destroyed in the worst case Thus the settings should be varied very careful Whether the galvos work good can bee seen and heard the galvos will begin to whistle if they are not in optimal condition Thus it could be advantageous to switch the music off for the finding of good parameters For the setup of the PPS rate a short story has been included into the ne
164. ls Windows Colour Table Signs Text Test Picture Into Help Fig 51 Figure Editor Menu Bar 58 161 00066470 DOC Version 1 0 EUROLITE HE 9 2 12 1 Menu File gt Open Laser Show This menu item Fig 52 automatically opens the Show Figure Editor Fie Background Image Edit Editor and the Windows standard dialog to load a laser Open Lasershow show Thus the procedure to click the button Show Editor Play List Load and to open the menu File Open Show is done via this Load Live Show menu item and lets you access a show more easily New Figure Save gt Playlist Load Save As This menu item automatically opens the Show Editor and ane Delete File the Windows standard dialog to load and open a playlist impart ILDA The playlist will be displayed and is ready to use Save ILDA Import ai file gt Load Live Show End This item opens a dialog to open a live show The Live Frstl ive Show ive Window will open automatically after loading the show Sauerstoff shw Fig 52 Menu File gt New Figure This menu item has the same function as the New Figure button see chapter 5 2 2 Graphic Functions To create a new figure this item or the corresponding button must be clicked gt Save Save As Save All These menu items have the same functions as the Save Save As and Save All buttons see chapter 5 2 5 File Buttons Save Save as and Save all gt Delete File This menu item h
165. ly when Auto Boot is deactivated If it is set this option serves for the same direction of movement of the effect on every calling of the figure Example A plane shall move up and down Thus the displacement Y effect is activated If the plane is called it will move up and down option Absolute Value not set If Always same is not set and the plane has already fulfilled a change of direction of movement first down now up then it will on the next calling go further 87 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor on with the up movement If the option had been set then the plane would move again down Absolute value This option defines how the value of the left scrollbar will act If this option is not checked then the setting describes a speed On the other hand if the option is checked then it describes an absolute value a rotation angle a defined compression etc Example Effect Rotation the Effect Value is set to 10 If Absolute Value is activated then the figure will be rotated by 10 degrees In that position it will stop and stay still Via the Show Editor or the Live Window the figure can be rotated further but only by defined angles If Absolute Value is not activated then the Effect Value describes a certain speed of rotation The scrollbar Start Value determines the value which is taken when the Auto Boot option is checked This value can be set only when it makes sense That is th
166. m Laserword They prefer shorter interpolation distances maximum distance laser off on approximately 700 and a slightly higher scan speed 30000 40000 PPS According to your Galvo system perhaps later some changes will be necessary for optimal show output The presettings done here are only chosen to prevent damage of the hardware Different galvos need to be operated with different optimized settings Later you have to do some changes of the settings with the help of test pictures for the fine adjustment to achieve optimum output To achieve optimum results some time and experience is needed Thus please have some patience Finally you should close the options dialog via the button Save Settings and Close Window If PPS rates above 25000PPS are set a warning message appears Fig 12 If you find it obsolete and do not want to get the message again please read the text carefully especially the last sentence The answer with the button Nein No will prevent the next appearance of the message Please note The nominal value For scanspeed is specified at 5 8 degrees of deflection IF you want to use Full angle deflection 60 degrees you should use 40 60 of nominal speed High speed at large angles can damage the scanners See manuals For suggested angles speed Should this message be displayed again Fig 12 Warning when a PPS rate is set above 25000pps 18 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start
167. max DAC simultaneously 11 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 9 Mamba mld The following is valid for hardware like Medialas USB Box MyLaserpage DAC RIYA and QM2000 which use the Mamba driver For a proper functionality of EUROLITE HE in combination with this hardware please copy the respective mld file from the folder ML_Driver to the program folder and rename it to ML_Driver mld please rename or delete a previously installed ML_Driver mld file After the program start of EUROLITE HE the respective driver should be displayed at the bottom of the list in the Options Hardware dialog Fig 3 You can use only one kind of MLD driver at a time This means you can use multiple RIYA DAC or Lumax DAC at the same time A mixture of different cards is not supported by EUROLITE HE Other drivers can be mixed e g EasyLase and Lumax together with a MLD card Tested combinations are listed in chapter 5 3 3 3 6 FriendlyName EUROLITE HE V allows to give the DAC cards FriendlyNames If it is supported by the respective card you can give your cards your own names via by clicking Set Device Name Examples are Main Projector Satellite left or Graphic Projector This simplifies the orientation during the setups tremendously The FriendlyName is stored within the DAC If you connect the renamed card with another system the FriendlyName stored will be displayed
168. me beams which will hit these mirrors If you store the corresponding figures within this folder you can use them within every show Thus it is not necessary to copy them to the show folder The folder HE_s_Testbilder contains some very useful test pictures to set up the projector Below some explanations will follow Additionally there are PDF files with descriptions how to use the test pictures German only The folder TestBilder contains some test pictures stored as bin files These pictures are shown via the menu gt Test Pictures Show Test Pictures IMPORTANT HINT The pictures in the folder TestBilder contain no point properties and will not be optimized as usual on laser output Thus it is not recommended to use them to optimize the laser output The ILDA test picture is used to determine the speed of the Galvo system This picture is put out without changes thus the detected PPS rate is correct 96 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 11 Buttons in the Region Window These buttons Fig 50 will open the respective window program windows or will enable the connected lue ndn functions respectively D a el gt Button Live Window This button opens the Live Window As already explained it helps to assign the figures to keys Its main function is the control of Live Shows Please read chapter Live Window for more explanations ETA Reset gt Bu
169. mes A gt B from Clipboard This function is only accessible via the menu It will paste the copied or cut the series of frames into the current figure The currently selected frame and all following ones will be moved backwards behind the pasted series gt Add Frames A gt B from Clipboard This function is only accessible via the menu It will paste the copied or cut the series of frames into the current figure They will be added starting at the currently selected frame This means that the new frame series will be an addition of the previous existing ones and the added ones To add means Assume that the frames O to 100 show a rotating plane Now you select e g frame number 50 and add then a 100 frames lasting animation which is stored within the clip board e g a jumping ball The result will be the following At the beginning frames 0 to 49 you will see the rotating plane from frame 50 you will see the rotating plane and the jumping ball This lasts until frame 100 From frame 101 only the rest of the animation jumping ball is seen without rotating plane With this tool you are enabled to create incredible effects Look at some existing shows gt Frames per Second This menu item is a copy of the function of the button Frames per Second gt Morph This menu item is a copy of the function of the button Morph 66 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt Morph All This menu item is
170. mething different All frames belong to one picture file and then only frames of the pictutre file are put within the Timeline frames which shall be displayed at a certain time and shall act on certain effects 161 161 00066470 DOC Version 1 0
171. moother output and stored on the hard disk The button Preview Stop will generate a simulation of the wave and stop the simulation The button Reset is used to reset all values The button Load Values lets you load previously stored values for the generation of a wave The button Save Values is used to save the values of the wave For the actions Load and Save the standard Windows dialogs are opened 79 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 9 2 13 2 Path Tool With this tool a new multi frame figure an Create Path animation will be created It will consist of several frames which will display a moving figure copies of a figure along a prior determined path In the simplest case this will be a short line which is moving along a given path But more complicated figures can be moved along paths The tool consists of several modules for the input A Input of Path Fig 2 shows the dialog to input the path You can draw the path with the mouse in the window of the dialog or you take the path from the currently chosen figure of ee e the Figure Editor via the button Path Fig 72 Extra Tools Path Tool Input of path from Frame You can check the option Ignore Blanking to ignore the blanked lines of your figure Tip The colors of the figure for the path Path from Frame can also be transferred Here figures with color gradient could give
172. mp soo i Export Settings Close Window Import Settings Fig 80 Dialog Options 5 3 Options With the dialog Options Fig 80 all basic settings for the hardware optimization language texts and more are done The settings except the show options are saved into the ini file The place where the ini file is stored is dependant on the operation system of the computer Windows XP e g stores the file in the Windows folder For Windows 7 and Vista the situation is more complicated If necessary you can get an overview on the paths via Options Others Show used software paths Show used Softwarepaths If errors occur due to a wrong ini file then it is recommended to delete it Then at a new start of the program the default settings are restored like after a new installation The push onto the red button Reset Settings of the index card Reset Settings will do this automatically Within the black line at the bottom of the Options dialog you can see the name and the path of the currently used ini file This is useful because you can prepare different settings and store them under different names then you have several ini files For this purpose a function to import or export the different settings has been created These functions are called via the buttons Export Settings or Import Settings If the files with different settings are placed onto the desktop after export with the file extensi
173. n assignment key MIDI value is necessary for a proper function Because it has to be defined which MIDI values shall push the respective keys This will be explained in more detail within the description of the Live Window Some knobs and controls have the data ALWAYS ZERO enter ZERO as a rule Zero means that the respective Data is not used for the selection In this case only the MIDI message number counts Two examples Example 1 also when not typical NoteOn NoteOn could possibly used for rotation when pushing a key the rotation becomes faster or slower Here Data1 is the number of the key whilst Data2 denotes the loudness Hence this means MIDI message 144 Data Value 2 Data2 but as selection rule we use 0 Thus exclusively the message number 144 is used as criterion Use Value from Data1 then means that the key number is used for the rotation Example 2 Pitch Bend At a 14 bit pitch bend one of the Data refers to the high byte the other one to the low byte Because EUROLITE HE only uses 7 bits only the high byte makes sense If the pitch bend wheel is slowly moved then you see both data values changing One goes slowly from 0 to 127 once whereas the other one always goes from 0 to 127 That means we have a 14 bit pitch bend event Thus in the example Data refers to the low byte always from 0 to 127 and Data2 refers to the high byte only once from O to 127 Hence the foll
174. nd This menu item closes the program gt Entries below End These entries list the shows shw or playlists pll which were loaded at your last 10 EUROLITE HE sessions This helps you to have very easy access to your favorite shows 5 2 12 2 Menu Background Image Via this menu a background image can be loaded to draw copy or raster To check the drawn figure the Laad Picire background picture can be hidden The loaded picture can Delete Ficure be also edited on a limited scale Background Image Visible w Hidden Background Image gt Load Picture oE sss Fe This menu item serves to load a picture jog or bmp Eii Backaruma inane which is put to the Painting Window as background 7 Fig 54 Because the window is quadratically the picture should also have this form The loaded picture can then 48 53 Menu Background be processed via the function Color Raster or copied by 48 hand the silhouette Colour Raster 60 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt Delete Picture This menu item removes deletes the picture from the Painting Window gt Background Image Visible Via this menu item the background image is made visible fe feigeriieee ft queer fee eee Coe ee effet ecu i om Fig 54 Figure Editor Background image gt Hidden Background Image Via this menu item the background image is made invisible hidden gt Edit Laser Frame Edit Backgrou
175. nd Image You can select Edit Laser Frame or Edit Background Image A selection of one of these items deactivates the other one If you select Edit Background Image your paintings will not be part of the laser figure but you can work with the Painting Tools on the background picture The selection of Edit Laser Frame enables further work on the laser figure gt Color Raster Tool Before you can use this tool you will always have to load a bmp or jpg file as background picture There are two kinds of operation modes of this tool Raster scanning and Take colors of background picture e Raster Scanning First use the New Figure button Then load the background picture Afterwards set a grid A measure about 8 to 10 Then mark a region on the background picture and finally click the Raster Color button Now a dialog to enter the kind of raster scanning line or spiral opens C Linie C Spirae After your input the region marked of the background picture will be scanned step by step A figure is created with its points colored like the Fig 55 Dialog to select the kind of raster background picture scanning ATTENTION With this tool you can produce tool figures consisting of too many points very quickly Possibly no DAC is then able to put the figure out Suitable numbers of points are below 4000 More points are senseless Let s calculate One frame has 5000 points 61 161
176. ne side is red then green then blue This works also for multi frame figures However only the colors of the first frame are pushed through In the following frames the original x y coordinates of the animation are maintained but the colors come from the first frame and will be pushed through Here it should become understandable that the number of points must be the same for each frame If that is not given then the missing points are set automatically by the software to have equal numbers of points for the frames Furthermore a number of new frames results according to the number of colored points within the first frame 71 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Now there are already a given number of frames because of the animation These two numbers of frames will be made equal by calculating the lowest common denominator of the two frame numbers Please do not be surprised on viewing the animation multiple times In very unfavorable cases the calculated frame numbers could blast the available memory of the computer and thus will cause an error message Hint Possibly it could be smart to use the tool Opt Distance of the special functions to receive smaller distances for pushing through colors gt Insert smooth colors Insert Color Gradient This tool inserts a color gradient There is already an option Use Soft Color within the Effects Window Indeed this function does the same But there
177. ng Hardware Ausgabe Farbkorrektur m Ausgabe Anpassung ET ae Ausgabekorektur Global sues ae D S spiegeln j Ausgabe H ardware Y spiegeln O 8A tauschen EET t Yerschiebung 4 Yerschiebung j j Drehung Showgriohe gt Verkniipfe X Y gt Merknilpte XA j So i re 4 cence t Grober 4 t Grohe 4 Trapez 4 Trapez Y ooo p Proj Abstand Fig 100 Settings of output parameters for ILDA Show export Ausgabe 0utput 123 161 00066470 DOC Version 1 0 EUROLITE HE show Editor Hardware For a 1 projector show only one hardware is necessary All tracks are routed to this hardware Only for multi projector shows you have to select more than one hardware Another possibility to export multi projector shows is to do it in several steps First export e g the track pages fort the main projector then those for the satellites Optionen Text Midi DMa Drucker Sonstige Ausgabe Optimierung Hardware Ausgabe Farbkorektur r Hardware r Hardware Zuordnung Ausgabeptad Routing A B C D Hardware 1 Lumar J J J Hardware 2 a s B Hardware 3 es se s Hardware 4 ae e Countdown Ausgabe Bilda suchen e w ie Fig 101 Settings of the hardware for ILDA show export Color Correction Best is to push Reset Color Correction It does not matter which lasers you have within your projector For the export as ILDA show a linear
178. nline chat during laser shows A setup with two or more computer screens recommended EUROLITE HE is able to control up to 16 output cards simultaneously The following combinations have been tested successfully e 11 NetLase cards each connected with an RGB projector e 1EasyLase 1 2 NetLase and 4 Lumax cards with a total of 8 projectors one Y cable Example for a favourable workplace 2 161 00066470 DOC Version 1 0 EUROLITE HE Functional Principle 2 Functional Principle of Laser Show Software and Projector This chapter provides information on the functional principles of laser systems and the software thus it can may omitted go on at chapter 3 Installation or chapter 4 Quick Start The underlying principle is the following Laser graphics are vector graphics A vector is a mathematical object with the attributes length and direction In our case this means that the galvo mirrors will move the laser beam from one point to the next one described by vectors Galvo is derived from galvanometer Originally this is an instrument with because of a flowing current in presence of a magnetic field within it a moving or rotating coil on which a pointer in our case a mirror is mounted Perhaps you will know it to be an instrument to measure voltages or currents in an analog fashion yet not digitally More precise information on galvos very often also called scanners can be found online e g www laserfreak net Th
179. nto the figure If a link has been created the calling of the figure will call the macro too The link refers to the key assignment Thus the DMX macro and the figure have to be assigned to the same key gt Button DMX Mapper Important The macros alter the values Of Srema the scrollbars These scrollbars are Add Schieberegler 1 gt Kanal 1 assigned via mapping to the real DMX OUT pee Reset channels Reset All Save Ag This button opens the dialog shown in Fig 123 In the region DMX mapping you bse Mapping can define to which DMX channel the AktuelerKanal1 receptive scrollbar will be mapped Multiple jj channel assignments are possible Fig 123 DMX Editor DMX Mapping The settings will be saved within the program folder on leaving the dialog via Close Mapping Several mappings can be used to control the DMX devices by Save As and Open The scrollbar to edit can be selected with the slider Aktueller Kanal or via a double click to the name of the scrollbar within the list This function enables the adaptation of different hardware combinations in different rooms by different users Several users thus have the possibility to adapt their DMX devices to a show even when the show programmer used a different mapping gt Macro Window Analog to the Figure Table within the Figure Editor a macro list within the DMX Editor exists In Note Of Figur AUS the Macro Window the mac
180. nung 0 Message No fi Ad Data value as condition ie Datal Data Value lo Use value from tf Datal f Data M Output track 0 Output track 1 A Output track 2 eee eee eceeeceaeeceee eee eco Fig 133 Live Window Midi Input routing assignment for timeline The MIDI Input routing determines which MIDI values are used for the respective regions Every MIDI transmission contains 4 different data MIDI channel MIDI message No Data 1 and Data 2 To use a MIDI value for the control of an event e g push a key it define which parameters should match for the received value of the currently MIDI command in order to be valid These definitions exist for two regions On the one hand for the Live Window and on the other hand for the Timeline For the Timeline we also have the old default setup Routing like record selection Fig 133 This means If the option is set button is pushed by default then just the green marking of the track in the Timeline is valid You select a track push on Record and then you can enter the effect values via pitch bend or modulation or select the figures via pushing keys For the Live Window and also the Timeline the filter rules must can be defined for the MIDI control of the individual regions The element to control is selected figure size rotation and then the Message Number and also one of the Data which has to be given for the usage of the other Data as
181. of the currently selected figure via DMX In total 20 DMX channels are necessary to do this The standard assignments are visible at Options DMX DMX Input Routing Fig 131 Then all is valid for DMX control what in general is valid for DMX The laser output must be switched on the DMX Input must have been set and so on How to use the Live Window please refer to the next chapter De routing Live Window El ras fe co Pop a E su col cl i tp Pp YP oo l ii mo oo U 149 161 4 4 4 4 4 4 4 4 4 4 4 DMX Editor Effekt assignment Figure Size Rotation Compression Compression r Intensity A Intensity G Intensity B Comp Asis 3 Comp Asis 1 Fotation Center 2 Fotation Center 1 Displacement s Displacement r Frame Mumber Rotation 2 2 Rotation 2 r Rotation 2 Z F1 F12 Intensity RGB Fig 131 DMX assignments for Live Window 00066470 DOC Version 1 0 EUROLITE HE DMX Editor 5 6 2 Control via MIDI As it is possible to control the software via DMX this is also possible via MIDI Again two regions can be controlled a The Timeline Show Editor b The Live Window For the Timeline and the Live Window a MIDI input routing exists gt Setup of MIDI Input Routing Since the Live Window exists we have to distinguish which function shall be controlled by what Basically al
182. of the Output Optimization for ILDA show export mi ILDA export 1 Load the show as usual 2 Push Menu gt File gt Export Show as ILDA file 3 Select target folder and enter the show name e g HE Show_ 25 fps 4 Confirm Type 5 with OK 5 Enter 25 frames second and confirm Now the ILDA file is created When ready a message is shown gt Create Show from ILDA file This menu item is used for the import of ILDA files From the number of the frames of the ILDA file and the length of the song the theoretical value of the frames per second is calculated The ILDA file will be imported like the ILDA figure import in the Figure Editor then for the newly arranged figures the frame rate is firstly proposed and then set at last a key assignment is done and the heb file for the figure of the ILDA file is saved A show file will be created with only one event on track 0 The show name as well as different options and further things will be requested The whole procedure requires a constant frame rate fps of the ILDA file seems not to be fulfilled with Mamba Furthermore errors at the color display can occur when the ILDA file is not a standard RGB file Eventually it is necessary to load the Pangolin color palette After the import the source ILDA file can be deleted At last a show file is generated which can be played via the software There are many cases where the procedure does not work Then the import has to be don
183. ojection gt Displacement x y With this function the text can be displaced to hit the desired projection screen The necessary values can be determined by firstly creating the text and then move it with the scrollbars of the Effect Dialog Notice the end values and enter them into the textboxes Furthermore it is possible to displace the text via the index card Output explained later gt Size over All This is the desired value for the size effect It determines the whole size gt Milliseconds per Frame The value entered herein sets the duration for a frame in milliseconds gt Letter Folder and Folder Save SMS The letter folder is the place where signs are stored It is only necessary when no TTF fonts are used Here it is important that the specifications are correct otherwise the program can not find the signs path given in letter folder When the program is installed a folder with simple letters is created automatically It is possible to edit the signs The folder save SMS is for the saving of your SMS text 5 3 2 Index Card Show Text Show Others Optimize Output q Reset Settings Output Colour Correction Midi Me Hardware Show p03 Camping tor Absolute Rotation Select new Audio File 0 01 Camping for Absolute Compression Funes FE Nene eng Runaway show N ame Save Show Sethings Fig 82 Dialog Options index card Show The settings done here will affect t
184. ol Fig 94 will be opened The tool works not very precisely thus the live recording of effects is recommended The reason is the handling of only bits for the effects Smooth wr Apply m Frame2 RasterDriginalalues Linear Time raster between min and Value Flaster max values Werteraster zwischen Minimas und ive taster Fig 94 Show Editor Window of the Effect Tool gt Create Edit Effects Select the effect tool and mark in the respective subtrack with pushed mouse button the region where the effects shall be placed Now the effects window Fig 94 will be opened Already existent effects are indicated by vertical lines length of line intensity of effect With the left or right mouse button events can be created in the window If you use the right mouse button then the alignment of the effects is controlled by the grid which is displayed by horizontal lines raster of 1 8 According to the kind of 115 161 00066470 DOC Version 1 0 EUROLITE HE show Editor effect which is edited this grid will work a little different The horizontal lines mark certain values of the effect If you use the rotation e g then between the lines are 45 respectively On displacements it will be 25 of the maximal possible distance gt Smooth By using this button on each click the changes of the effect intensities are smoothened by computing of the average More clicks result in more smoothening Attention The start v
185. ol Lt Uri The assignment of figures to keys is saved automatically as file key ord within the same folder as the figures Changes of the assignments are possible by a re assignment Duplicate assignments are possible several keys for the same figure not opposite To call several figures with one key Showparts are used 29 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start On overwriting a figure by another one within the show folder the other figure is given the same name within the Windows Explorer the assignment to the name of the figure will be preserved The assignment key figure is thus done via the figure name ia Live Window File Controller Zuordnung la x r Taste T Optionen Live Show Name M Use Key Up Event Flash P Swich off unused tracks DMX Assignement Rotation Compression x r Displacement x bi Rotation 2x intensity AGB V Output Track 0 A E DMX Start Value Output Track 3 R hs a Output e 8 F9 F10 F11 F12 255 4 255 4 DM Stop Value Fig 18 Key assignment within the Live Window It is also possible to do the assignments automatically via the menu Figure Assignment of the Figure Editor The already made assignments can be viewed or printed out by clicking the respective item within the menu Figure Assignment of the upper menu bar of the Figure Editor The easiest and q
186. ol all tracks we need in total 12 19 228 DMX channels Again some examples Track 0 on page A is controlled by the channels 1 to 19 in total 19 channels Track 1 on page A is controlled by the channels 20 to 38 in total 19 channels Track 2 on page A is controlled by the channels 39 to 57 in total 19 channels Track 3 on page B is controlled by the channels 58 to 76 in total 19 channels And so on Because it is hardly possible to keep this all in mind a somewhat intelligent DMX controller DMX board or software is necessary where it is possible to write down the assignment in clear text Because it is e g not very simple to calculate the needed channel for a rotation of the figure in Track 7 Page C this would be the channel 7xX19 3 136 because we have Track O thus the Tracks 0 6 have 6 1 x19 channels plus 3 to reach the Subtrack Rotation on Track 7 and because we now assume DMX Input Offset 0 But anyhow with the help of the DMX software control it is possible to replace the complete Timeline the tracks on the pages A D by a DMX board if it is sufficiently intelligent Thus you can integrate laser projectors into an existing DMX light control there are truly some discos which use it 5 6 1 2 Control of the Live Window via DMX 148 161 00066470 DOC Version 1 0 EUROLITE HE You can push the keys for the calling of figures by DMX Also it is possible to change the effect settings
187. on Laser ini then you can start EUROLITE HE via a double click to the respective Laser_ini file with the desired settings e g for graphics beam show output of text etc 90 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor After the import of settings they are applied and stored automatically Attention Eventually you must store your old settings before you import new ones For this an automatic restart of the program is done The restart is necessary because a change of the hardware settings during the running program is not successful without a new initialization The index card Hardware is already explained in its own chapter 3 5 thus it is not necessary to explain it here again 5 3 1 Index Card Text Show Others Optimize Output Reset Settings aaa Colour Correction Midi DMs Hardware Text fig Mas Number of Signs jao Milizeconda per Frame jo f Use Compression x 4bsolute Letter Folder lo Displacement s C ProgrammeSHE_Laserscan_Y Buchstaben_S0Shaddow_ Arial sete lo Displacement 7 Folder Save SMS feo Size over all Ci Fig 81 Dialog Options Index card Text There are two ways to enter text The first possibility to enter text is placed in the Figure Editor Choose this text button painting tool A to enter text in the painting window To change the font or the size of the letters click the tool with the right mouse button The other possibil
188. on will make it possible to draw Bezier curves This tool can help to easily draw complex figures but a little training and the ability to imagine the desired figure is necessary Generally a Bezier curve is created with the help of two control lines which consist of 4 coordinates The two control lines are shown as red lines on the icon These are naturally not visible in the drawn figure The 4 coordinates are created by pushing and releasing the mouse button The drawing of the Bezier curve is thus done by pushing the mouse button twice mouse movement and releasing the mouse button After the second releasing of the mouse button the curve is created 44 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor a The first point of the control lines will appear where the mouse button is pushed the first time This point determines the start of the Bezier curve b The second point appears where the mouse button is released the first time The first control line is thus drawn with pushed mouse button The direction of the line in relation to the first point determines the direction of the start of the Bezier curve the tangent The length of the line determines the strength of the orientation of the curve in this direction c The third point appears on the place where the mouse button is pushed a second time That point is the end of the curve d The fourth point appears where the mouse button is released again for the last tim
189. or DMX assignment This assignment determines which MIDI controller value or DMX channel respectively will push the assigned key Routing Output routing This assignment determines which track pages ABCD each with three output tracks are put out on which hardware card DAC All changes have to be saved If you want to use your settings new show again then click Save Live Show All possibilities especially MIDI will be explained in detail in the Main Part 4 8 Creation of a Live Show The creation of a live show is similar to the creation of a standard laser show Basically the following steps must be taken 1 Make a new show folder on your hard disk 2 Create figures with the Figure Editor and save them 3 Assign figures to keys by drag and drop into the Live Window 4 Verify the settings for each key and eventually correct them 5 Save the new live show by clicking Save Live Show 32 161 00066470 DOC Version 1 0 EUROLITE HE Main Part 5 Main Part In the following part all controls and their functions will be described The manual will no longer follow the development of a show but the description of the menus and windows It is best to work through the whole manual and test every function of the program for a first overview Should questions arise when working with the software use the search function to get a quick answer 5 1 The Windows of EUROLITE HE EUROLITE HE uses several
190. or display the picture must be created with another program The show part can be edited via a right mouse button click it too The program will open the Show Editor automatically to edit the show part After editing the changes must be accepted by menu gt Show part gt Apply Remember to store the show part figure by clicking Store with the button of the Figure Editor The current show will be buffered RAM Thus do not switch off the computer else the edited show could be lost 121 161 00066470 DOC Version 1 0 EUROLITE HE show Editor gt Open Show This function is only accessible via the menu An existent show can be opened via this menu item Because of the use of the same file extension Mamba shows will be shown too But if you want to open a Mamba show a message will be shown and the open process will be stopped Furthermore it is not possible to open shows which are created with the LW Showeditor and vice versa An additional possibility to load shows is the use of the playlist or double click the show file extension shw within the Windows Explorer gt Save Show This function is only accessible via the menu With this function the currently loaded show is saved If the show was not saved before has no name then a dialog to enter the show name will be opened Otherwise the current show will be saved without any request gt Save as This function is only accessible via the menu This menu
191. or to the point where a magnification is wanted Then rotate the mouse wheel If the zoom is set to 100 on selecting the magnifying glass depends on the use of the right or the left mouse button 49 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 4 Frame Tools Frame Tools Hew Frame A figure can consist of only one or of many frames i Delete Frame single pictures Figures consisting of several frames are often called Multiframes Unfortunately there is a lot of name confusion when E different programs are used Some programs name it Multiframes some Animations some just Frames Pa ae Thus please be indulgent Fig 41 Frame Tools In the show the single frames of a multiframe figure are called up by timer or by the effect subtrack Frame Number where the user can define prior by hand the wanted frames of the figure Thus it is possible to create small animated cartoons or animated figures like deforming planes etc At the start a figure consists of one frame with current number 0 To work with multiple frames or to create more frames for the figure the Frame Tools Fig 41 are needed gt New Frame Left mouse button A click with the left mouse button on the button New Frame will add a new empty frame at the end of the current frame series The scrollbar in the bottom of the Frame Tools below Frames per Second will automatically jump
192. orizontally the steps are always 1 degree 104 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Size X Y globally Via these scrollbars the size of the figures in general globally is adjusted the difference between global size and show size will be explained below When X Y linked is checked the second scrollbar is activated when adjusting the first one too Trapezoid X Y With these scrollbars the output geometry of the projection can be adjusted to get e g a square on an inclined wall instead of a trapeze This function depends on the setting for the Proj Distance Proj Distance Here the distance from projector to screen for laser projection is adjusted The control works similar as the perspective control in the Effect dialog The screen which distance is set here can be mounted in any inclined position thanks to Trapezoid X Y It is adjusted how much the border of a square near the projector is prolonged until it looks equally long as the more distant parallel side Hint All these setups are globally and determine the limits of a rectangular scanned with maximal size Size X Y Size of Show Via these scrollbars the size of the show is adjusted When X Y linked is checked the second scrollbar is activated when adjusting the first one too Important The difference between global size and show size The two kinds of sizes may be a little bit confusing but they are necessary This effect ha
193. ormation about the Figure is shown 5 2 1 Creating and Editing of Figures To create a new figure you have to push at first the button New Figure see Fig 33 If you miss this you could work asiel further on a existing figure perhaps unintended The creation of a new figure is indicated by the vanishing red square figure 0 in the upper left of the Figure Table When you click New Figure Unde New Figure the buttons description will change its color to Hedo gray and is not active and later back to black The duration ZN A of inactivity depends on the amount of data of the previously a alo E edited figure 0 S New Figure is preparing all conditions to paint a new figure Fia 33 Figure Editor Figure 0 is selected from the table and the following values Graphic functions are set Number of frames and number of points are set to zero the current effect settings remain unchanged If you want to edit an already existent figure than select it by a click with the left mouse button The selected figure is indicated by a red square around its icon see for example Fig 17 and shown in the painting window The name of the figure is shown at the top of the Figure Table If present its key assignment is shown too The name and the assignment of a figure is shown in a popup window too when you move the mouse cursor to its icon and wait for a short time about one second 39 161 00066470 DOC Version 1 0
194. owing just for information The two frames which shall be morphed into one another are calculated to have the same number of points according to the frame with the most points Now in the previously defined count of steps the picture points are shifted gradually from their start position start frame to their end position target frame Additionally the color values are gradually adjusted It is advantageous when the respective points of start and target frame play the same role in the pictures the numbers of points are casting For example the points which design an eye should do this in the start frame and in the target frame too But that is mostly very difficult to achieve Thus sometimes unwanted effects after using Morph could occur like a moving of all points to one center and then an expansion to the target frame To morph polygons if these have a multiple number of corner points e g 6 12 works very well However in this case you should create polygons without overlapping edges Morph will calculate the given number of frames to insert between two frames start frame and target frame Thus these two frames must exist before you can use the tool If you click the button a dialog will open to enter the current number of the start frame look at the top of the Figure Editor for the numbers of the frames and after entering the value another dialog to enter the number of the target frame opens At least a di
195. owing parameters are used MIDI message 224 For DataValue Data is selected but as value 0 is entered Thus the low byte is ignored The right selection for use value from is Data2 Pitch Bend and Note ON Off are somewhat exotic within MIDI The rest of the controllers and buttons is nearly always the same A message number refers mostly to a block of the MIDI device at the Oxygen e g all sliders or all buttons etc One 153 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor of the Data refers mostly to a single controller button of all existent controllers buttons within the block The other data then usually is the varying value which is used for the control of effects or keys MIDI is unfortunately somewhat complex because of the unusual data structure The control of the software via DMX is much simpler because there are only channels Each channel just receives values form 0 to 255 EUROLITE HE reacts at the time only to one MIDI channel This one channel you can define Controllers which use more than one MIDI channel are not recommended for the use with EUROLITE HE 154 161 00066470 DOC Version 1 0 EUROLITE HE Live Window 6 The Live Window It shall serve for the use of laser projectors live to the music of a DJ within a disco or something else As for a music synchronous laser show which is prepared with the Timeline Show Editor and then stored to the harddis
196. parameter How to use all the functions will be explained exactly in the Main Part below The work on marked points cut copy paste is similar to a text editor But the well known shortcuts like Strg C copy Strg X cut and Strg V paste can currently not be used to edit the figures because they are used for the figure to key assignment Even a whole series of frames series of pictures of a figure can be edited cut copy paste or add via the menu Frame Functions In case a figure should consist of several single pictures series of frames which later can be displayed as an animated cartoon you have to create a new empty frame picture by clicking New Frame Thus a new frame is generated at the end of the existing ones On the contrary Add Frame will add an empty frame within the series at the current position in front of the current frame The other functions like Morph will be explained later in the Main Part A newly created figure can be directly put out to the hardware displayed by the laser projector by clicking Laser On 22 161 00066470 DOC Version 1 0 EUROLITE HE 4 3 Show Folder Save Figures To be able to create a laser show with an already prepared collection of figures they have to be stored within a show folder Thus you should create a show folder in advance with the Windows Explorer Within this folder all used figures together with the later use
197. pay attention to the fact that beneath the keys F1 to F12 the program knows the FO key too FO means no function key used The behavior of the function keys depends on the setting of the feature Use Key up event Figure off in the menu Settings of the Show Editor Timeline If the option is not set default setting then a certain F page is selected by pushing the respective F key All program windows will show the currently selected F page By pushing another F key the selection can be changed By a second push of the same F key the selection is canceled and the FO page is selected If the option Use Key up event Figure off is chosen the respective F key must be pushed and held down when pushing the figure key Hint The function key F10 could make problems because often this key is occupied by the operating system for menu functions This is a Windows problem 24 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start 4 5 Assignment of Figures to Keys After the creation of the figures they have to be assigned to a key of the PC keyboard or MIDI keyboard respectively This is needed urgently for a later use of the figures because the Show Editor the Live Window and also the DMX Editor as well as the MIDI input need this assignment to use the figures For example in the Show Editor at the process of creating a show the figures are called by pushing the respective keys to the beat of the music Certainl
198. pletely because the color correction and the correction of geometry will be calculated nevertheless IMPORTANT The test pictures with file extension bin will not be optimized to the greatest possible extent The pictures from the folder HE_Testbilder will be optimized because these are normal HE figures gt Color Shift R G B The three scrollbars Color Shift are used to put out the colors switch the lasers a little before or after the figure is scanned The reason is that the lasers are faster in their response then the galvos in very rare cases the lasers are slower This difference in the speed is corrected by setting the appropriate values By the use of these scrollbars those for Frame Start Point Repetition and Frame End Point Repetition are always changed too That is because the program needs enough points to shift the colors xxx points gt Output Hardware The selection of the respective hardware DAC is done in the upper right list box Output Hardware Remember All settings refer to the hardware number which is selected here not to the real DAC That means when changing the DAC for hardware 1 the optimization parameters for hardware 1 set up for the prior used DAC will still remain unchanged Example For hardware 1 the scan speed was set to 30kpps Hardware 1 was for this setup a NetLase connected with a Raytrack35 galvo system If now for hardware 1 a slower galvo system i
199. ppings 5 4 2 5 Menu Settings gt Start Stop Laser Output automatically Settings Video Play list Infot Counte Check this item to start and stop the laser output y Stat Stop Laser Output automatically automatically E eee ae Use Migieelania gt Use Key Up Event gt Figure off Create Grid Check this item if you want that the figure display Rezet to stop on releasing the assigned key Key pushed gt figure on key released figure off Jeee S Enter delay for Show Start If this option is not selected only the pushing of s 107 Show Editor Menu Settings the key is evaluated Then the figure can only be stopped by another one or by pushing the Space key a blue line at the stop position will be displayed in the track When recording of a DMX subtrack you must take care on using the Key up Figure off option as well as on using the Space key Errors may occur IMPORTANT HINT This option influences the usage of the function F keys As described above the key assignment is changed now combinations with the F keys can be used before the combinations with Strg Alt and Control could be used Remember that also within the program FO is existent no F key pushed The use of the F keys depends on the setting of Use Key Up Event gt Figure Off in the menu Settings of the Show Editor If not chosen each F page is chosen by a short pushing of the respective key The F page can be chang
200. r Text Show Others Optimize Output Reset Settings Output Colour Correction Midi DMs i i Hardware Assignment Output Routing A B C D Hardware 1 vitua Device e d u d Hardware 2 Vitual Device E a Set Devicename Hardware 3 Virtual Device o i Set Devicename Hardware 4 Ho Device st isi sY i Set Devicename Hardware 5 No Devis O e i Set Devicename Hardware 6 NoDevice i sts lt lt tsisY s a 6g Set Devicename Hardware 7 No Device isis Y ee ee Set Devicename Hardware 8 NoDevice t iti s sY Set Devicename Hardware 9 Ho Device ssi e ee Set Devicename Hardware 10 NoDevice tis ae a Set Devicename Hardware 11 Ho Device s i i sY e ee Set Devicename Hardware 12 NoDevice sts e i Set Devicename Hardware 13 No Device s i s s i Set Devicename Hardware 14 Ho Devices sti i s sSY e ee Set Devicename Hardware 15 NoDevice titsti s sS og a A Set Devicename Hardware 16 Ho Device siti e ee Countdown Output Search Audio DAC a i Export Settings l Fig 3 Menu Options Hardware for the selection of the hardware cards DAC Meanwhile up to 16 cards can be used The shown setup is useful for a simulation ofa 1 2 projector show typical setup 8 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 1 Simulation
201. r four scrollbars are present In the lower right the settings of the respective colors are displayed graphically Via the extended color correction also curves with non linear characteristic can be set e g to get more brightness but then the colors may be displayed not correctly any more The Min scrollbars determine the modulation voltage when the lasers just begin to shine These scrollbars should set a little below the laser threshold to have dark In Fig 89 you can see for example an offset for the blue laser it will begin to emit light when the modulation voltage reaches about 1V The Max scrollbars determine the modulation voltage for the highest brightness which the lasers should have at all for your understanding Assume that the green laser is much too bright compared to the red and blue laser to get a good white balance Then scale down the green Max scrollbar to lower the brightness of the green laser until you get a fine white The scrollbars in the middle are similar to those of the parametric middle of an audio mixer The horizontal scrollbars determines the position of an interpolation point where the increase or decrease adjusted with the horizontal scrollbars starts With these controls a nonlinear response of the laser brightness can be set Some tips to adjust the color correction Load the folder HE_s_ Testbilder again and select the already prepared figure GrauVerlauf_Testbild_SolltelmmerWeisSein
202. r live shows also beam or graphics The two versions are similar The only difference is that the time line from where the figures are called is in the first case recorded in advance and in the second case it is put in anew live each time by the light jockey The show output however basically is always the same and will be done by the program in the following way The start of figures which consist of many points as well as their color information all stored within the RAM of the computer will be addressed by an event which is written down in the show track or via direct call from the Figure Table or Live Window The coordinates of the points and intensity values will be calculated according to the effect settings the distances between the points are optimized by interpolation corner points will eventually be repeated and at least after a correction of the geometry they will be put out to the hardware The selection of a figure together with its effect settings can be done manually as mentioned above via the Live Window or automatically by an integrated Show Editor with tracks If the Show Editor shall do this operation the necessary events have to be set up in advance on the tracks Manual control of the figures can be accessed by a PC keyboard DMX console or by a MIDI keyboard in real time Depending on the respective hardware e g hardware connected with the parallel port the software has to additionally calcula
203. r one what is possible e Remember Show parts are no figures or animations but only calling lists for figure changes or changes of effects e Generally each show part should be arranged in the way that after its run the called figures are terminated this is not a must but is recommended e Show parts can be used for the Live Window too Via this you can call figures and effects for several tracks by pushing just one key Basically the creation of a show part is done as for normal laser shows Timeline shows But it will be created only a part of a show e g for a chorus This part can be used several times within a laser show but it is not recommended to use every time the same part for a refrain it could become boring To create a show part click New Show part choose the music this is a must also when the show part is later played without music via the Live Window and then record the events for the wanted Show Part For this all effects and figure tracks can be used If the creation of the show part is finished click menu Show part gt Create Show part from Sequence By doing this the show part is saved within the Figure Table as figure The Show Editor will return to the current show In the Figure Table now a figure with yellow design is present That is the show part The icon can now be edited via a click with the right mouse button Select Edit Show part Icon to insert a picture f
204. remove the ini file s except problems occur when starting the software 2 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview 3 3 Hardware Overview EUROLITE HE supports different types of DAC hardware for laser output DAC Digital Analog Converter These types will be described in a random order and the necessary steps to use them will be reviewed The interface cards DAC can be selected in the register card Options Hardware In the drop down lists you can select the installed cards For special applications it is possible to select the same card in two lists That is useful if two different settings e g output options will be applied But at the same time it should be used always only one of these lists If both lists are used at the same time the laser output will be flickering An example for such an application would be a mixed show with graphics and beams For the graphics the output is set to fit to a screen for the beams a setting with different parameters is chosen Another possibility of an application could be the use of a playlist containing a mixture of different show types e g graphics 1 projector beam 3 projector beam 1 2 projector beam etc This kind of use is explained in the chapter Playlist In a future version it is planned to give the possibility to enter a user defined description for the name Hardware e g Main Projector Satellite 1 Graphic Projecto
205. rifying of Settings gt Show used software paths On pushing this button an information window is opened where the paths are listed which are used by the software to store the different files ini files undo files etc gt Show Speedometer when screen is black With the help of this option the speedometer can be switched on or off It will be displayed when the screen is dark e g when a show is started via Play HQ but not switched to standby The speedometer gives information about the number of frames which are sent to the DAC It helps to find out why the show output is flickering Reasons for flickering can be the optimization settings e g too much corner repetitions too small distances too many points of the figure and a PPS rate which is too slow too Attention The maximal PPS rate is determined by your Galvo system Hint Displayed are the numbers of frame actualizations This means how often the memory of the DAC is actualized How often the DAC repeats a frame on output or if frames are omitted can not be evaluated with the speedometer gt Style of Color Selection Here it is possible to display a color circle instead of a color cube in the Figure Editor see above Here you can select the kind of display Recommended is the color cube because it exactly shows all colors which can be displayed with HE The color circle is a design of the colors of the Pangolin color palette The choices are less
206. rollers But that does not matter because every controller slider can serve for all possible effects The live show is started by clicking Laser ON As soon as the laser output is running the show can be played The individual figures can be selected by a Mouse click left button b Pushing the respective key on the keyboard c Touchscreen d DMX e MIDI The currently selected key can be identified by its green surrounding frame see Fig 24 key 1 The Space key switches off all projections Taste Optionen Use Kep Up Event Flash MW Output Track 0 Swich off unused tracks Output Track 1 A Output Track 2 DMS Start Value DMS Stop Value Fig 25 Detail view of the Live Window after loading a live show IMPORTANT For each key different setups can be made Here is a short summary Use Key Up Event Flash This option determines whether the output is switched on until another projection is chosen for the respective output track or if the projection is stopped immediately on releasing the key Switch off unused tracks If this option is selected then all figures on other tracks are switched off if they are not used by this figure Output Track 0 to 11 Here it is possible to select on which track s the figure is put out Remember that you must have in mind the routing to the track pages ABCD of your projectors Selection of effects 0 to 5 sliders Within the Live Window
207. ros existent within the current folder are listed With a mouse click they can be selected for editing or output Fig 124 DMX Editor Macro Window A key assignment is not possible here This is done via the button Keyboard Assignment see Fig 122 The already done assignment of a marked macro can be read in the upper region of the Macro Window gt DMX Macro Note off Figur Aus Note off is equivalent to Release Key On DMX recordings the NOTE OFF function works too Thus a macro can be stopped by releasing the respective key e g lamp on off but then the NOTE OFF macro is called which will invariably set all DMX channels to 0 This could be very disturbing if Moving Heads are used If only one channel should be set to 0 then the release key function is not usable In that case you should write an additional macro which sets only the desired channels to 0 140 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor 5 5 2 Intelligent DMX Use intelligent DMX devices will change the view of the a AAAS File Edt Operating Mode Zuordnung DMX Devices DMX Sevice A DMX Device Deven List pee List irs List Lz xY Joystic f4 Raster File DMX Maste E Eom Start DMX Qutput m Note Of Fig igur AUS Macro Steps Edit a New zm E 4 No of intermediate steps E B ms per intermediate step
208. rrent Dongle number equals the Dongle number enabled to give rights it is possible to enter another Dongle number Then all rights are given to the new Dongle number e Only users with dongles can get protected shows e Protected are all figure files and all show files e Before the protection it is recommended to make a copy of the show IMPORTANT Please make a copy of your show in advance of the protection gt List of Show Names and Playlists loaded at the last sessions At the bottom of the menu File the 10 last loaded shows or playlists are listed for easy access Click the name of a show or playlist to directly open it 5 4 2 2 Menu Show part This menu was already explained above creation of show parts menu New Show part 5 4 2 3 Menu Edit This menu offers some functions to edit the show Edit Tools Settings Video gt Undo do This menu item has the same function as the button Dikar ea ee Undo Look at its description above for more information gt Output selected events This function is only accessible via the menu Fig 105 Show Editor Menu Edit Marked events figures can be directly displayed by the projector if the laser output is set to ON gt Cut Copy Paste These menu items have the same functions as the respective buttons Look at their description chapter 5 4 1 6 for more information 5 4 2 4 Menu Tools This menu contains the tool Beat Counter Tools Settings Wideo Play List
209. rs the test picture AlleMuessenGleichzeitig Ausgehen This picture shows 4 elements in red green blue and white These elements fade very slowly to dark and then become bright again The aim is to A let all colors become dark simultaneously and B to let the white element always be white even when it disappears For a color correction method use the picture Farbabgleich_nach_Ralf Information how to use this method is given via the pdf with the same name as the picture you can find it in the folder HE s_Testbilder Some words about TTL lasers If a laser can only be modulated by a TTL signal on off then the TTL box must be checked The consequence is that all brightness values will be put out with full intensity Attention If the original figure will become smaller and darker with analogue lasers then the TTL laser will radiate with full intensity DANGER The option TTL works in the following way If a laser color is exactly set to zero laser off then the DAC will set OV at its output for the respective laser As soon as the laser color is no longer zero then the DAC will set 5V at its output The reason is that TTL signals or inputs have only two levels above 2 5V means ON below 2 5V means OFF But if now a show e g displays a slowly fading off wave then without the TTL option the wave will become invisible below half brightness With TTL option set the wave will still be visible until it is really off But w
210. s These are the points two and three compared to above In the strict sense point b above is skipped by the 3 point Bezier method and two points of the control lines are set on the same place 45 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor The slider for the point distance defines the number of points to draw the curve The slider can determine a density of points or a number of points When number of points is chosen then this means that regardless of its length every curve will consist of the same number of points This can be very advantageous if a later morphing of curves is planned Morphs of Bezier curves can result in very nice figures If density of points is chosen then the number of points of the curve is dependent on its length The option last point of figure will be start point is another variant for the creation of Bezier curves If chosen then only the missing control points must be drawn The first start point is already given by the first mouse click and this is also the end point of the curve Additional hint Because the program at the drawing of Bezier curves can not know how it will go on generally no invisible end point is set Thus after each Bezier curve the question appears if the line shall be ended with an end point This is not avoidable because it is very important for the output optimization to have a blanked point at the end of a line 5 2 3 Marking and
211. s i e the playlist will not work if the show files were moved to other locations changed folder etc In that case you have to delete the record and to insert the show again gt Violet Arrows Via a click these buttons the previous or the next show is activated gt K marked 130 161 00066470 DOC Version 1 0 EUROLITE HE show Editor gt Green Arrow Blue Square gt o By clicking the button with the green arrow the currently selected show is started When the show is playing the button shows a blue square Click the button to stop the playback of the shows gt Button Close Window l This button closes the playlist Clicking Display again to load Llose Window the previously loaded list gt Button Via this button shows are added to the playlist gt Rubber This button deletes the marked show from the playlist not the show gt Vertical Green Arrows Al v Via these buttons the marked show can be moved to ce within the Playlist gt The List Within the list a show can be directly selected Make a double click to start a show After the replay of the show the output is stopped The routing of the marked show can be done on the right side of the dialog gt Output Routing and Speed Via the output routing the user can define the routing of each show and the output speed too Attention When the routing was changed via the playlist do not save the options it will create confusion
212. s Dialog First some generally valid explanations The Effect Values are usually in the region of 100 to 100 when the effect is bi directional can run in positive and negative directions For rotations the region of values is bigger from 180 to 180 or from 0 to 360 or even more respectively 86 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor The Reset Button s sets the current value to the standard value usually this means effect off This value must not be stringently zero e g for the size the standard value is 100 Logically the respective scrollbar is set to the standard value too The scrollbar on the right hand is not affected its function will be described later in detail here it should only be mentioned that on a repeated calling of the figure the values could be set to the old values using this scrollbar The Reset ALL Button will actuate all single Reset Buttons The scrollbar Effect Value is generally used to set the desired value which is displayed in the textbox Value nearby Within this textbox Value it is possible to enter the desired value manually But the response to this value is dependent on the option Absolute Value At effects like rotation compression displacement and for the axes the standard value is in the middle of the scrollbar for others it is on the right side The specialty The effect commands coming from the show tracks or via DMX
213. s advantages but also disadvantages The advantage is that some figures look very impressive when they suddenly move to the outermost limits The disadvantage however is that it is not sure for all figures to be correctly placed on the screen For this reason the global size was implemented The global size will additionally make the output size smaller as if the amplitude of the galvos would be scaled down on the driver Let us stay at our example Assume that both sizes are set to 50 What will happen to our square First the whole projection region will have half of the maximal size due to the setting for global size The square thus will have half of its size Furthermore the output size will be reduced additionally by 50 according to the setting at show size Thus the square will be projected with 25 of its normal size If the displacement effect is used then the maximal possible displacement is determined by the global size and this is set to 50 thus only half of the maximal mechanical scan angle can be used By this it is secured that the intended region set up with global size can not be exceeded But now it is possible to use the displacement effect Many users may think that this would be silly only the half scan angle will be usable That is not true Because when the global size is set to 100 at all it will be ignored If the output size is to small then the reason is the galvo system itself Surely it
214. s are possible To open the dialog to adjust the simulation click the right mouse button on its window or use the menu Options A second right mouse button click will close the dialog Via a click and hold on the center position of the selected projector allows to move it The selection of a projector is done with the radio buttons on the right side of the dialog On closing the window the setups are stored into the ini file 9 161 00066470 DOC Version 1 0 EUROLITE HE Hardware Overview Fig 5 shows an example for a simulation setup with 1 plus 2x2 projectors one main projector and two satellite pairs For hardware 1 and 2 the X axis should be mirrored A B C D Hardware 1 VitualDevice Le J I Hardware 2 Virtual Device in in Hardware 3 Virtual Device RDC F Hardware 4 Virtual Device ivi i Hardware 5 Virtual Device e vie Hardware No Device sti T fF T pP Fig 5 Simulation with Virtual Devices Tip Because it is possible to start EUROLITE HE via a double click to an ini file it makes sense to make a separate setup for the simulation Virtual Devices positions of projectors movements etc and to export this setup as e g simulation ini An ideal place for such an ini file is the desktop If you make a collection of ini files with several setups and place them onto the desktop then start EUROLITE HE with the desired setup very quickly via a double click If no
215. s not usable for moving heads the respective channels are set to false Create Edit DMX Device Label To dim Master sensitive Start Address False False False False False False False False False False False False Channel 7 False False Channel 8 False False False False False False Channel 11 False False Channel 12 False False Channel 13 False False Channel 14 False False False False Channel 16 False False Channel 17 False False Channel 18 False False Channel 19 False False Channel 20 False False Channel 21 False False Channel 22 False False Channel 23 False False Channel 24 False False SSS Fig 126a DMX Intelligent DMX Edit DMX Device No of Channels Channel RED Channel GREEN Channel BLUE gt Channel High Channel Low Y Channel High Y Channel Low TET Device Name Select Picture gt Channel Red Green Blue If these channel numbers are entered referring to the start address then a RGB color Use DHX Denies selection field will appear later Cios Fig 127 If no RGB device is used just enter a 0 i Save DMX Device DMX Gerat erstellen bearbeiten Master empfindl Stattadresse rue Tuse gt X and Y Channels 2 Tn ine 7 Kanalzahi If these channel numbers are ins we pe 1 an entered referring to the start Kanal in Fake Fake anal Blau alse se address then later a XY gt fabe fabe joystick field appears The field E a Fale Fale
216. s or Letters To create your own signs or letters first select one of three HE fonts In the left upper textbox you can enter the desired letter to copy by hand The letter will be displayed in large in the respective window The size and the position of the letter can be varied via the three scrollbars Now set the coordinates of the points of the new sign with the mouse For a uniform set of signs you should not vary the settings of the scrollbars Click Save Zeichen to save the new sign or letter in the previously defined folder Options Text IMPORTANT The start and the end of the letter or sign have to be blanked points Otherwise you will see colored connecting lines later on The software can do this see red circles in Fig 68 but to be certain set the blanked point again right mouse button The advantage of these self made letters is their lower complexity and thus a laser output with less flickering is achieved Furthermore special signs can be created and then be used within the Figure Editor A tip Wingdings has some signs which could be useful for a graphic show 73 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor B Settings for text short and longer text and creation of longer text How to use these options has been already described in the respective chapter of the Figure Editor Grafic Functions gt Text Tool Here a short repetition To create long texts you have firstly to selec
217. s used e g a Lumax DAC with K12 galvo system then this Galvo system will be overloaded because the PPS rate is still 30kpps for hardware 1 Each hardware projector can be optimized separately Tip Use the mouse wheel to scroll comfortably within the list of hardware gt Scrollbar PPS With this scrollbar the output speed of the currently selected hardware is set you can enter directly a value too When a frame is projected it will be done with xxx points per second The user sets up HIS PPS rate depending on his galvo system If the PPS are set the first time on a value exceeding 25kpps then a warning is displayed see Fig 12 Please read carefully the displayed text and give your answer to the question correctly Later the warning will not be displayed anymore if wanted For the setup of the PPS rate please read the next chapter gt Picture Center after every Frame If this option is selected the galvo mirrors will move always from the picture center to the first point of the figure and from the last point back to the center For some galvo systems this is necessary If you are not sure whether your system needs it it is 100 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor better to select the option Widemoves can work without this option Simple devices China galvos will need this option The movement to the center will need about 20 points additionally but it is secured that no extreme distances will
218. s used then you have access to all possible effects at the same time gt Sliders With the sliders the respective effect intensity is adjusted Hints Rotation The rotation is not switched off when the slider is in the middle At the highest and lowest positions the rotation speed is zero Just on approaching the middle the rotation will become maximal and will abruptly change the direction in the middle This kind of regulation has been adapted from DMX controllers Some sliders will be invisible when another window overlaps or when the Live Window is not maximized Display of the sliders Unfortunately sometimes the buttons of the sliders are not visible especially when they are overlapped by another window That is just a disfigurement gt Other important hints concerning the operation Via a click with the right mouse button onto a figure the small dialog shown in Fig 140 opens Delete Assignment With this item the assignment eee of the figure to the respective key is deleted change KeyCode assignement Fig 140 Live Window Click with Change KeyCode Assignment is an important pieced ua r e feature for all countries with another keyboard layout In Germany there is the QWERTZ keyboard but in many other countries the QWERTY keyboard is used The Z and the Y keys are interchanged but 158 161 00066470 DOC Version 1 0 EUROLITE HE Live Window nevertheless the have the same ASCI
219. scari_ oo ae ee FRE C ProgrammeSHE_Laserscan_ AGB Ini Files Im E port C ProgrammesHE_ Laserscan_ Automatic Settings C ProgrammesHE Laserscan_ User File Path C Dokumente und Einstellungen C ProgrammesHE_Laserscan_ W Wave Qenerator Settings 5 E 7 Define autoload show Reset autoload Export Settings Fig 10 Menu Options Selection of English dongle plugged into USB port whether your USB interface dongle was recognized correctly Fig 10 You can see the series number of your dongle In future this number is necessary for the copy protection of your exclusive shows if desired In this window you can also define standard paths which are chosen automatically on program start green arrow As a rule If any parameter is changed within the options it will become immediately active To use the changes after the next program start the settings have to be saved by clicking the yellow button Save Settings and Close Window see blue arrow in Fig 10 The next step should be to choose the register card Hardware Here you can select the hardware or verify the ones automatically selected by the software As mentioned above the various operation modes support up to sixteen DA converters Although you can select the hardware devices 1 to 16 only hardware no 1 will be addressed by the software when the freeware version is in operation Also only one figure track can be used within the Show Editor
220. seeeeseeeseeeeseeees 144 5 5 2 9 Menus of the DMX WINdOW oe cece cece cece ccececeeeecececeecececeeeeeeceseeaeeeseeaeeeenenss 145 5 6 Control of the Software via DMX and MIDI ccceeeeeeeeceeeeeeeeeneeeeeeeees 145 5 6 1 C ntrol via DMX acess ncces tte tine issue ge e a arra ia eke reaa a E a iaa 145 5 6 1 1 Timeline Window Show Editor DMX Control cccccccceeeceeeeeeeeeeeeeeeees 145 5 6 1 2 Control of the Live Window via DMX 0 0 c cc cececeecececeeceseeeececeseeeeeeseeaeeeeneaes 148 5 6 2 Control via MIDI 0 eee eee ccc ece ce eceeeeeecececeeeeseeeeaeeeeeseeaeseseeaeseseseeaeeeseeaeneeenaes 150 6 The Liv WINOGOW ascsac stn ne creegannesciaesiceneedeasdagnavddawcegentredaaveccecs 155 SOW PINS ics eects E EEE 160 6 FINUS eee seccresiee ns cee ee eee nee E E E E 161 8 1 Conventions ice sede cdece sede ce ce dectedeeddecetecenececedendeenecenecedecenecededeneeenededscetedececededecens 161 8 1 1 Beam Zone and Audience ZONE eee eecececececececeeeeeeeecececeneeesececeseeeeaeaeaeaeaens 161 8 1 2 Assignment of tracks tO projectors ccc ceccceeceseccceeeeceeeaeeeceeeteneeseeesaueesaees 161 8 2 Terms ANd Names ccecececececeeeececececeeeeeeeaeacueeeeeueeaeaceceeuaeauauanaeueuauaeeveneeeeees 161 This user manual is valid for item number 51885500 You can find the latest update of this user manual in the Internet under www eurolite de 3 161 00066470 DOC Version 1 0
221. set DMX routing Save DMX in routing Load DMX in routing Fig 130 DMX assignments Options Midi DMX DMX Input Routing Now we develop a formula for the DMX Input Routing The first DMX channel for a Laser Track is Laser Track Number 19 1 The last DMX channel for a Laser Track is Laser Track Number 19 19 Thus the following channel assignment is valid Page A Laser track 0 First channel 0 19 1 1 Last channel 0 19 19 19 Laser track 1 1 19 1 20 1 19 19 38 Laser track 2 2 19 1 39 2 19 19 57 Page B Laser track 3 3 19 1 58 3 19 19 76 Laser track 4 4 19 1 77 4 19 19 95 Laser track 5 5 19 1 96 5 19 19 114 And so on lf we break it down onto the respective subtracks then we obtain the following Selection of figure track number 19 1 Size track number 19 2 Rotation track number 19 3 Compression X track number 19 4 Compression Y track number 19 5 F key track number 19 19 147 161 00066470 DOC Version 1 0 EUROLITE HE DMX Editor The DMX track can not be called via DMX input This channel selects the F key The DMX channel assignment is thus exactly the Subtrack order within the Show Editor from bottom to top At least we achieve the formula for the DMX channel DMX Channel DMX Input Offset Lasertrack Number 19 Number of Subtrack where Laser track number runs from O to 11 Subtrack number from 1 to 19 To contr
222. sitions to default S ee places can be directly accessed Bitmap trace Move colors throught Insert smoth color gt Special Functions This menu item is used to access special additional functions of the program They can be very useful for the conversion of ILDA files The most important tools are Live Window Fig 61 Menu Windows 67 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor e opt Distance could perhaps optimize your figure if later the extra l xl tool Path Tool should be used Functions of Figure E ditor explained later This function pepe tort divides the distances of a line into SS CURE U cs shorter pieces as long as the in the 2 tr Options entered value for Max Distance Laser ON is higher than the length of a piece Functions of Show E ditor Change colours to HE Colourtable values Delete each second frame Increase blanking distances e Change colors to HE Color table values If you have imported an ILDA file with an own color Remove Extra Points palette different from the HE palette e g Pangolin then this button will a a ila convert the colors to the HE color l i Normalice AGB Point Mas brightness from each point at same palette After the procedure the file calor can be used together with other HE sae a a OMalice lame omnts of Bach tame as same figures The imported figure can be colar i l stored as h
223. sly created figure will be edited further Figures Always on Top Delete Frame Undo Hedo Hew Figure IZ J A aloes 5 File Fig 14 Buttons for editing Now a figure can be created in the black painting window by the use of the computer mouse or other kinds of input devices After each start of the program the graphic function PolyLine Tool is active With the left mouse button colored points will be set with the right mouse button invisible blanked points will be set Remember that we are now creating vector graphics In case that a second line with a new start point shall be drawn the laser beam must move invisibly to the start of the line Thus you have to set a blanked point with the right mouse button If you use any other painting function the generation of this invisible vector is done automatically Here a short summary of the graphic functions zZ Polyline by keeping the mouse button pressed a rubber band like line to the end point is visible This tool is used e g to draw bent laser planes Ellipse With this tool the tunnel effect is created The circle or the ellipse respectively will be interpolated by a many cornered polygon The number of points of the figure is size dependent That is important when Morph should be used later The lines between the polygon points can be recolored Point The output of a point will create a still standing las
224. splacement Displacement Y lt I lt I Frame Number Vv Vv v Vv Vv Axi Vv Axi Vv jor m jor m i Iv i Iv Vv Vv Vv Rotation2 Rotation Rotation2Z E E E E E E E E E r z E E E TA I The Effects Dialog Fig 79 is opened via the button Effects in the Figure Editor Because it is basically a sub window of the Figure Editor it is described here The Effects Dialog is used to determine the behavior of the effects of the respective currently selected figures Furthermore the conditions on start for the effects of the figure are configured Each figure has its own settings of effects Thus these settings are stored together with the figure To apply effects on a figure is done in the following way Firstly a figure is painted Then the effects dialog is opened and different values are entered Afterwards the figure is saved On calling the figure it does not matter if via Show Editor or via hand or else the programmed effects are set What then happens is very dependent on the settings Depending on the settings of Start Value the settings act as start values or not lf a new figure is created then it has the effect settings of the previously created figure in the beginning When the program settings are stored via Options the currently used effect settings are saved as default settings too Description of the Effect
225. st gt Damping for Absolute Rotation Compression If the Absolute option is used with the effects then the here entered values are active The damping helps to prevent discontinuities in the laser projection Small values result in a strong damping No damping is present when the entered value is equal to one If the entered value is greater than one the projection will be discontinuous or will overshoot For the most shows the values remained unchanged by the users gt Select new Audio File This button has a special function If it is not necessary it is gray and will not operate Each laser show has its own assigned audio file The place of this file will be stored within the show file path and name If the file is missing or the path had changed then EUROLITE HE will not be able to find it on loading the show A message will displayed Audio file is missing When the message is called the button will be active Now a new file which has to be stored within the folder of the show can be selected gt File Name Song Only for information Here the file name of the audio file is displayed But it can happen that a new name for the audio file of the show must be assigned That is the case e g when a wave file has to be replaced by a mp3 file because to save memory Also when the show is used on another computer and the path had changed then here it is necessary to change it At least it is necessary when you downloaded
226. switch the options in the field Laser To make a white balance for shows the Laser Blank Mode must be used The scanning must be set to Helix After working through the procedures displayed in the text box a pre setup is done The scrollbars for the colors shown in Fig 87 will be set according to the pre setup If a laser color is not present the respective scrollbars will be set to zero Then this color will be distributed to the other lasers The Color Correction will operate in the following way when colors lasers are missing For example when blue is missing the original blue color will be distributed to equal parts to green and red when it was only blue Thus blue will be replaced by yellow If blue was originally in combination with red purple color then the blue part will be distributed only to red the same is valid for blue green combinations gt Extended Color Correction Min Max scrollbars for RGB Fig 89 shows the extended color correction 108 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Hardware 1 Virtual Device Uutput Hardware Blue Copy colorsettings to Min Max Lolour Corecton sr Reset Colour LCorection A Show Blanked Lines f Intensity Brightest Colour C Intensity Grey 5 cale aV A Fig 89 Dialog Options Extended Color Correction The above described pre setup already changed some scrollbars in the extended color correction For each colo
227. t If the program is crashed in most cases the last status of the show can be recovered by the Undo copies of the software ATTENTION When the program is started it checks if the folder Temp is still existent on the hard disk If so then that is a hint for a prior crash or something similar Then the program offers the chance to recover the last setup Please read the message carefully When the program was properly terminated the Temp folder is not existent and thus no message will be displayed on a new start Then the undo copies are deleted definitely 29 161 00066470 DOC Version 1 0 Start of recording green arrow time progress bar blue EUROLITE HE Quick Start 4 7 Load and Use a Live Show The live window serves for several functions above we had just the function of the key assignment Generally it shall serve for live control of a laser show This means the LJ light jockey controls the laser output via the respective input device when the music is played For this purpose he can prepare live shows in advance One show example is already included in the delivery This show can be loaded and you can play with it to learn the use A live show is basically a collection of figures already assigned to keys Furthermore the live show contains the options for each key on which track the figure shall be put out does the key flash or not which effects can be controlled via the scroll bars which MIDI DMX
228. t when DPSS lasers were not available mostly multi line Ar ion lasers up to 8 spectral lines or Kr ion lasers or mixed gas Ar and Kr with up to 13 spectral lines were used for laser shows with so called color boxes dichroitic filters or acoustic optical modulators AOM PCAOM to generate different colors For high power purposes those lasers are often used today too HeNe gas lasers were are used as well 2 161 00066470 DOC Version 1 0 EUROLITE HE Functional Principle To achieve impressive laser shows some preparative steps are needed Firstly graphics in future called figures have to be created or painted and to be saved on the computer For this purpose the software offers different tools similar to graphic editors Furthermore every figure has its own setups of effects and parameters for the optimization of the output A figure can consist of several pictures later called frames like an animated cartoon Different figures together with the respective music and other different files like the show file or the file which contains the keyboard assignments must be jointly saved for the show within the show folder When the show folder or the laser show respectively will later be opened the figures will all be put into the random access memory RAM of the computer and subsequently they can be sent to the projector Now two kinds of shows can be used there are music synchronous laser shows beam or graphics o
229. t the font Then enter your text into the window on the right side of the dialog This can be up to a full DINA4 page Then click Create According to the text options the program now generates the laser display of the text The text will be displayed in several frames depending on the length If possible the word wrap will be executed at empty signs space If desired the change from one frame to another can be done via morphing The button Options will open the Options Text window The Options Text settings will play a great role for the output of long text and SMS messages For tests create a message and try to display it with the laser projector Then try via Effects to get the wanted target position The values determined in this way can now be entered in the respective text boxes of the Options Text dialog Then later received SMS messages should be displayed at the correct position gt Enable SMS Generally the SMS reception is only possible via SIEMENS TC35I GSM Other mobiles are not tested and will probably not be supported SM5 from Siemens TC35i Laser Output GSM Status None C Morph Text C Scrolling Text COM Port Settings Comport Waehlen v fi 9200 v OK Cancel Read all SMS from mobile IV Save log file Delete SMS on mobile Send answer PC gt GSM Modem GSM Modem gt PC Answer Your SMS has been receive From Time TEXT I Output on demand
230. t which is connected by a straight line with the previous one Use the right mouse button to set an invisible point or a blanked line To draw two single lines with this tool you have to set a blanked point at the start of the second line for the start of the first one this is done automatically To understand this imagine what happens when you draw a picture with a pencil You start on the upper left and then you draw a line to the right Now for a second line you have to move the pencil to the start of it and what do you do You lift the pencil And you move it without drawing to the start The same happens when a blanked or invisible line is drawn tool was used and a change of the painting tool is done then the drawing is automatically checked on the existence of an invisible end point When this point is missing a message is shown 40 161 00066470 DOC Version 1 0 gt Line gt Point p MA EUROLITE HE Figure Editor NI This button will make it possible to draw single lines planes in the projection It is generated one single line with start and end A line consists of blanked start colored start colored end and blanked end of the line Thus at least 4 points are generated to create the line t This button will make it possible to draw single points beams ATTENTION A single point will be displayed as a beam in the laser output These single beams can be very bright Do not set a single po
231. te the correct timing between the single points Unfortunately that involves a not negligible additional work for the computer and thus it is very dependent on the capacities of the computer The result of these additional calculations will be that the show will not be displayed as smooth as it could be when another kind of quasi intelligent hardware is used Because of the above mentioned reasons intelligent hardware like EasyLase Mini Lumax Medialas Riya or other is recommended The BILDA or the LPT DAC parallel port is less appropriate and will not be supported by the software to 100 Nevertheless these DA converters short for digital analog can be used and will continue to work in combination with the software TIP Often you will find an additional function or control elements or menus within the software by means of a right mouse click 6 161 00066470 DOC Version 1 0 EUROLITE HE Installation 3 Installation 3 1 New Installation mo Install the control software EUROLITE HE on your computer For this purpose start the installation program Eurolite HE_V msi on the supplied DVD and follow the instructions of the installation program Connect the USB interface to your computer Freeware To work with the software in freeware mode start the program without the USB interface connected Then only one projector hardware and one laser track is available for use Also some tools e g path tool may be used but t
232. the black line your clicks are too fast and if the bar is below the black line your clicks are too slow compared with the calculated average bpm rate With Stop Song the playing of the song is stopped By clicking the small cross in the upper right corner the beat counter window is closed Attention Do not miss any beat after starting the procedure Otherwise the result bpm will be wrong The BPM is calculated from the average temporal distance of the entered beats The longer you click the beats the more precise the calculated BPM will be gt Wave Generator Path Tool Stretch Lines Bitmap Trace Through these menu items you will have access to the extra tools Wave Generator Path Tool Stretch Lines and Bitmap Trace Their functions will be described in chapter Extra Tools below gt Move Colors Through Push Through Colors This menu item opens a little window This serves to push through the colors of the single figure points through the entire figure Example Assume a triangle side 1 shall be red side 2 green and side 3 blue In total there are 3 colors 4 if the blanked points are included too If the colors are pushed through a new figure is created consisting of 3 4 frames You will always see the triangle but on every change of a frame the respective color has moved further by one point Thus you will see the sides of the triangle changing the color every frame first o
233. the dialog Options Output Optimization Set all point optimization controls to their minimum Extra Points Line Start Corner Points etc set to zero Leave the Max Distance controls as they are Now adjust the Color Shift scrollbars for each color start and end of the sides of the triangle shall be precisely colored the points shall have no small lines Ignore rounded corners and imperfections of the picture during the adjustment After the adjustment procedure the optimizations extra points for corners etc can be set up Please look at the pdf file Farbabgleich_nach_Ralf pdf which is stored within the folder HE_Testbilder It is written in German but possibly may help to adjust the settings too look at the pictures therein Settings of the scrollbars for interpolations max distances extra points line start end and optimal PPS rate These settings will be possibly needed to be done repeatedly To receive optimal values for a certain galvo system an approach in small steps can be necessary Generally all settings will influence each other If the optimal values are found once then a new setup will be done easily For the setup only some tips can be given Generally the default parameters are chosen in that way that no Galvo system will be destroyed Thus here is much potential to increase the performance of the laser output The setup of the optimization should be done in the following way
234. the distance of the points and for the case of a figure moving on the path the distance of the copies of the figure which are taken for the movement only every second third etc The value set at Count of pictures lower scrollbar determines the length of the serpentine or for the figure which number of figure repetitions will be moved on the path The option Start End hidden blanking on start and end determines whether the figure at start and at the end of the path will be shown Yes or not No A little exercise It is possible for example to move a writing hand along a writing The writing itself can be created with the tool Stretchline Thus it is possible to let the hand do the writing This needs some exercise and patience To create this animation was the basic idea to program the Path Tool 81 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 2 13 3 Stretch Lines Tool The Stretch Line Tool creates a GEE MIE new figure This figure consists lofi multiple frames it is an animation The animation will show a figure which is quasi just z Line Strech for komplete frame drawn In other words The tool is mm a Appl used to rise up make them big eS the figures a single line or a Attention if the beginning of a figure hase a blankend S i standing beam i point followed by a color point a standing Apply fo o 4 je possible comp
235. the show without audio file and when you converted this from your own CD to an mp3 or wave file So you can look for the right name or you can change it with the help of the button Select new audio file usually this is not necessary when the song is included in the show folder gt File Name Show Just for information The name of the show is displayed This is the name for the storage of the events of the track s seq file and the color table hep file It is possible to store several shows with different names in one show folder gt Save Show Settings This button must be used to store the changes It offers the same function as Save Show of the Show Editor 93 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 9 3 3 Index Card MIDI DMX Text Show Others Optimize Output Reset Settings Output Colour Correction ee BR Hardware ial 150 DM2 Channels Options for printer i r l Print width for 1 octave Fess bee Output 50 No Device Frint Height for 1 octave DMS through MIDI DM Ports Selected MIDI Port Change Input No Device mie E Live window Not Enabled Pono f Automatically if live window is open Not Enabled Port 0 I Ignore Size Control 20 lnput lnterval when Laser Output is stopped in ma 5000 Input Intervall when Laser Dutput i running j DHS input offset Setup Midi input routing DMs Input Routing Fig 83 Dialog Options
236. ties for setups which refer to the currently pushed key The key just pushed can be seen from its purple border The key that was pushed and released afterwards can be seen from its green border The properties of the keys are refreshed by pushing the keys How to create and assign figures has already been explained in detail in the former chapters If the mouse is moved over the keys then the possible animation of the figure is displayed Show options Tschosef LiveShow Automatic Mode Window on top Save live show The following properties and functions are accessible In the part Show Options Fig 137 you see the name of the live show and buttons to save and load a live show as well as the button to switch on or off the laser s Laser On The button Automatic Mode opens the Automatic Laser Player see chapter 5 2 12 6 Menu Window The next part of the Live Window shows the key options Fig 138 The frame text displays the label of the key for which the options are valid in Fig 138 key number Zy gt The border of Key X Options here with the label Taste Z Optionen contains the options of the respective key Z 156 161 00066470 DOC Version 1 0 EUROLITE HE Live Window Taste lt Uptionen Use Key Up Event Flash Jw Output Track 0 Swich off unused tracks Output Track 1 A DMA Assignement OMY Start Value Output Track 2 181 es Dee Shop Value
237. tion More information on this is given below This function is rather mentioned to EDIT the shows Pr Play HQ This is the recommended method Shows for presentation should always be played by using the Play HQ button This function switches the monitor off depending on settings at Options Because the monitor is switched off no output to it is necessary the program will run faster Furthermore it is guaranteed that the show starts at the beginning All files and settings are reset and the show will be displayed correctly That is not always guaranteed by the use of the Play button That function should be used to edit the show Moreover it is possible to set a start delay by a right mouse click above the Play HQ button or via the menu Settings Enter Delay for Show Start One important hint additionally to missing audio files If the audio file is present in the show folder but is not correctly recognized by the program a message will be displayed Audio file not present The reason is mostly a different file name or path The correct file name including the correct path can be set up in the Figure Editor at Options gt Show gt Select new Audio file 2 161 00066470 DOC Version 1 0 EUROLITE HE Quick Start 4 2 Create Own Figures and Shows When a new figure shall be created always click New Figure at New Figure first Otherwise it could happen that a previou
238. to default positions of the different windows button Reset only Windows Positions is now available This is very useful if you have distributed the windows to several monitors but later work only with one monitor 111 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor 5 3 10 Buttons at Options Export Settings Close Window Import Settings Fig 91 Buttons at Options gt Buttons Export Import Settings Via these buttons the settings can be exported or imported respectively A dialog to enter select the name for the exported settings will open gt Button Close Window By pushing this button the Options Dialog will be closed without saving the changes On the next start of the program the old settings will be valid again gt Button Save Settings and Close Window Via this button the changed settings are stored permanently The changed settings will be valid at next program start too It is important to use this button after changing the color correction Within the black area the path and the filename of the currently used ini file is shown 112 161 00066470 DOC Version 1 0 7 EUROLITE HE Show Editor 5 4 Show Editor orEvents 1699 Imin 17sec mr a m Fie Showpat Edt Tools Settings Wideo Play st Infott Countdown ae l Cut Undo l Redraw j a gt a m timeine pec on opie DMes Macro l itaim Loop Play
239. tton Show Editor Fig 50 Figure Editor Buttons to This button opens the Show Editor Please look at 00 windows or select functions chapter Show Editor for more information gt Button Effects This button opens the Effects Dialog Please look at chapter Effects Dialog for more information The settings of the Effect Window refer always to the current figure gt Button DMX This button opens the DMX Window Please look at chapter DMX Window for more information gt Button Options This button opens the Options Window Please look at chapter Options for more information gt Button Laser ON This button switches on your projector for the laser output of your figures If Play HQ Play or Stop is clicked within the Show Editor this button is used automatically too The caption of this button tells you what will happen when you push it In case the Simulation Window is opened but minimized then this will again be displayed normally and the output is directed to it The simulation is closed via a click on the X in the upper right corner of the Simulation Window gt Button Simulation This button opens the Simulation Window Please look at chapter Hardware Overview Simulation for more information If the simulation is used no output to the laser projector is possible gt Button Black Screen This button disables the monitor of your computer This can have an enormous effect on
240. uccessful installation Thus please read the tutorials on this subject If the plugin is active you will see the Softwarecave logo of Winamp s VB Link see Fig 64 in the upper left corner of your screen Push the button Enable of the automatic player and the plugin will be used for the frequency analysis Now activate the tracks by clicking the respective Start button Then you should see the amplitudes of the different frequencies in the window of the automatic player see Fig 63 69 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Please pay attention to the fact that the tracks are assigned to frequencies Hence track A is more assigned to the bass low frequencies track B to the middle frequencies and D to the high frequencies Six tracks react to the left music signal the others to the right signal Forms Extres Teboj lo Fenstor 7 BJ v 2 Jona a9 17 There are different functions which can be altered but to explain all would be too much Thus here is a short description Viewalratoe plugins Soioct a visustraton pumn befow The selected plugin can be fsunched using he Star buton below ce by using Cri Shik from Winamp The automatic player uses 6 frequencies of the audio spectrum For each frequency the average amplitude is calculated The damping for each average frequency value can be varied via the scrollbar Damping GenemiFupane amaa fr
241. uency analysis in real time for the desired song For this purpose a Winamp plugin called Winamp VB Link is used it is not an included Figure Editor ioj x w Automatik m Output Path 4 7 Sensitivy Minimum Yolume Klick Beat 4 pl 4 gt Klick Beat Ji OK Klick Beat 4 J gt Output Path B Stat fa Bh Klick Beat T bl alt Start oh Klick Beat 4 J O Ha I gt Start OT Klick Beat 4 IKIN J gt Output Path C Start 4 Klick Beat 4 rl 4 gt Start 4 Pj Klick Beat 4 o Ha a Start 4 ha Klick Beat 4 bj 4 gt Output Path D Start 4 Wh ___Klick Beat o r 4 Start ry Klick Beat 4 4 gt Start ha Klick Beat 4 gt 4 gt E wiaempL n4 2 E Band Spakin rr Liclable Every band hits the KlickBeat button every time if the average value is higher than the sensitivy value If the volume is lower than the minimal volume no frame will be displayed on the track Reset everything Sampling rate Damping Save Settings af bla E gt Load Settings Fig 63 Automatic Mode Automatic Laser Player feature of the software You have to instal it manually Please look for the zip file vblink10 zip within the program folder of this software The file readme txt describes the installation of the plugin Winamp and the plugin do work with all Windows operating systems Possibly it could be necessary to use different tricks to get a s
242. uickest way to check the assignments surely offers the Live Window This will be opened on selecting the menu item Show PC List According to the selection the assignment is displayed or printed out It is also possible to open a list of the free keys Examples for the display as list or keyboard view are shown below Fig 19 To close the lists use OK upper left or make a double click it WARNING The window could be open and hidden in the background An additional possibility to find out the key assignment of a figure is the yellow popup window which is shown when the mouse is placed at least one second on the respective figure Furthermore you can read the assignment of the figure at the top of the Figure Table 26 161 00066470 DOC Version 1 0 E 0 mn mM gog wo P C ras IT Fig 19 Assignment tables for computer or MIDI keyboards 4 6 Create Music Synchronous Shows After all figures are created and assigned to the keys the creation of a show can be started To start the creation of a show click the button Show Editor Fig 20 or open the Show Editor via the menu Windows of the Figure Editor Firstly within the menu File of the Show Editor the menu item Create New Show has to be selected see Fig 21 Then an audio file has to be selected in the following dialog To chose an mp3 file a changeover to the file type has to be done If a wav file is used an intensity overv
243. ultiple repetitions of the corners dependent on the optimizing setup for output For a circle no points are repeated On the other hand a polygon with about 100 corners without optimization will look very similar to a circle gt This button will make it possible to draw ellipses circles The center of the ellipse is set with a click the left mouse button Hold the mouse button pushed and pull the ellipse up to the desired size The rule is the width is dependant on the horizontal and the height on the vertical mouse movement If you release the mouse button the ellipse is drawn with the prior selected color By clicking the right mouse button over the ellipse button the number of points of the ellipse can be varied The dialog shown in Fig 35 is opened Only values between 7 and 40 can be entered Smaller numbers result in more points of the figure of the same size the feed rate is done in smaller steps Enter feed rate for ellipsis 7 bis max 40 bigger values gt less points Abbrechen Fig 35 Figure Editor Dialog after right mouse button click tool ellipse 43 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor Points of ellipses circles have very special properties The lines between the points will not be optimized interpolated at the laser output Thus you should never delete e g half of the points to get a half circle To get a half circle it is better to set the color of the unwanted points to black
244. very easily create a playlist from a folder and its subfolders A dialog opens to select the folder After selection of the folder push the button Alle Shows im Ordner laden and in a few seconds the playlist is completed This list can be edited as usual 5 4 2 9 Menu Info txt The info txt file is created by the show programmer In this file some information from hitch bat CAB LIREIa Sein you about your show should be stored Display File info tet Display the info tet automaticall This information should include the author the eooooOOO_ song file the used or proposed galvo system and some specials about the show still standing beams or anything else Fig 112 Show Editor Menu Info txt This part of the program has been completely edited for version 4 A dialog with several index cards is opened Fig 113 to fill in the proposals for the use of the 132 161 00066470 DOC Version 1 0 EUROLITE HE show Editor show All info is recommendation any assignments or PPS rates have no influence on the real show parameters gt Display File info txt A click this menu item opens and displays the info txt dialog gt Display the info txt automatically If this option is chosen the info txt is displayed automatically at the opening of a show Laser show Show name n show creator Media file Date Technics Software version Projector placement Beamshow Output Routing Graphic show
245. ves and other periodic figures This tool is not very difficult to handle and you can get satisfactory results just by playing A little knowledge of the mathematical description of waves see below can help to handle the tool but that is not a must Figures can be created with the Wave Generator via Try and Error too 76 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor The principle of the Wave Generator is the following The Wave Generator consists of 8 single generators Each can generate its own waveform The amplitudes of the waveforms are dependant on space and time The amplitudes theoretically begin with a range from 100 to 100 because the real amplitude height of signal at least arises on the combination with a point property The amplitudes can be assigned to a point property like x y coordinate or color Because all generators have the same operation principle it is sufficient to explain only one Every wave is characterized by amplitude frequency in space period in time and phase The frequency describes the number of peaks and wave troughs in the space In the Fig 1 the frequency is 1 for wave 1 and it is assigned to the y coordinates with amplitude 20000 Thus the generated wave has 1 peak and 1 wave trough in total The generator for wave 2 is also assigned to the y coordinates but has a frequency of 10 and smaller amplitude of 5000 That generates the smaller wave with 10 peaks
246. vice list gt Button Use DMX Device This button is present within the edit device window and within the intelligent DMX window see next chapter If you push it here in the edit device window then the device is inserted immediately into the device list without saving it That is arranged in this way because it is possible to save a complete device list For your safety it is recommended to store all devices separately 5 5 2 2 Button Use DMX Device Use Via this button stored devices can be loaded into the program It is DMsDevic possible to create a list of devices see for example Fig 127 Since version 5 1 j several devices can be selected simultaneously to edit macros For this first a device is selected with the mouse and then the Strg key is pushed and held down Now use the mouse to mark and select further devices DMX File Edit Operating Mode DMx Devices RGB Movinghead S Edit DMXx Device Flot 250 MitteRechis Use DMx Device o a AL A Y Y Tr Save Pix250 MitteLinks Device List Load Device List Clear Device List Piot250 Linkten Stroboskop Flamemaster Links Flamenmaster Reachits RGB Movinghead v KY Jopetic ja Raster Fig 127 DMX Intelligent DMX DMX device list colour field and XY joystick field If a click is done on one device of the list then its functions are displayed on the right side The example
247. will be done is defined within the show part Thus do not be astonished when the figures of a show part which is defined for e g track 2 are put out on totally different projectors e g projector defined for track 4 gt Scrollbars DMX Start Stop Value s With these two scrollbars the DMX value range for a control via DMX is set After setting the value range the button Apply has to be clicked gt Scrollbars MIDI Start Stop Value s 157 161 00066470 DOC Version 1 0 EUROLITE HE Live Window With these two scrollbars the MIDI value range for a control of the respective key via MIDI is set After setting the value range the button Apply has to be clicked gt Buttons Assign all Keys to DMX and Map MIDI automatically If many figures are used we have about 600 key combinations the DMX and MIDI value assignment can be done automatically via this button gt Selection of Effects Within the dropdown lists above I SI mI COE COG the sliders see Fig 139 the effect which is controlled by the respective slider can be selected All known effects are possible and additionally the RGB _ intensity brightness can be selected For every key other effects can be chosen These 9 sliders are used Fig 139 Effect scrollbars and dropdown lists above to control the respective effect via mouse or touchscreen You can chose 5 of the possible effects and put them onto the sliders If DMX or MIDI i
248. will change the properties of the points Type of points Welche Optimerungsmethoden sollen verwendet werden 77 Fig 40 Point Optimizing Tool dialog The line of thought is the following A rectangle consists of 4 corner points and the lines between them A Galvo system without optimization is not able to only project these four coordinates because of its resonance and its physically given inertia its mass Galvos which are too slow are not able to correctly display the corners The rectangle will become more like a circle Galvos which are too fast show mainly the corner points and the lines are missing Thus it is necessary for each Galvo to optimize the ways to move the kind of movements For the optimization the four lines between the corners will be interpolated divided into small line pieces The 48 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor corner points will be repeated several times to get them sharp The number of small line peaches and of the repetitions of the corners is dependant on the Galvo system And these kinds of optimization are called the properties of the points line points have other properties than corner points Each element circle square letters etc has its own properties In order to let to know the software how to work with the respective points and lines each point has certain properties These properties define how to optimize the output for the
249. windows for different functions Experience has shown that the number of monitors plays a role It makes sense to distribute the different windows to two or more monitors for comfortable work If only one monitor is available perhaps with a resolution of only 1024x768 pixels the number of windows could possibly become confusing Then the task bar must be used for the organization of the windows Generally EUROLITE HE saves the positions of the windows when they are closed If this poses a problem then via Options Reset Settings Reset only Window Positions the default positions can be reset The Figure Editor serves for the creation and managing of the figures and partly for their output to the laser projector Furthermore the main window the other windows can be reached from here File Background Image Edit Figure Assignment Frame Tools Windows Colour Table Signs Text Test Picture Info Help Figures Always on Top Output Path lA 0 v Frame Tools C C Colour 4095 Window j Li TT TTT TT W S C Buchstaben_3DShaddow_E C Buchstaben_Normal FixFiguren _ Univer C Wave_Geneator_Settings Fig 25 The Figure Editor 2 161 00066470 DOC Version 1 0 EUROLITE HE Main Part The Options with several register cards are used to manage the basic settings of the software hardware setup language optimization of output etc Text Show Oth
250. xt chapter But before the procedure is done it is the best to know the optimization functions The optimization has the following properties e The optimization of the laser output is done in real time e Each hardware has its own optimization values e In the strict sense the correction of geometry and the correction of colors belong to the optimization of the output too These are accessible via the index cards Output and Color Correction respectively How to find the best optimization settings will be explained after the description of the elements First a description of the elements of this index card gt Extra Color Point at Line Start This is the number of additional points on a color change new color at the start of a line It is valid on the transition blanked gt Laser On as well as on a change from one color to another 98 161 00066470 DOC Version 1 0 EUROLITE HE Figure Editor gt Extra Color Point at Line End This is the number of additionally points on color change at the end of a line before another line piece is drawn with another color It is valid on the transition Laser On blanked as well as on a change from one color to another gt Corner Point Repetition Here the setup is done how often a point will be repeated when its property is defined as corner point More repetitions will result in sharper but also brighter edges Corner points are mostly defined automatically on the cr
251. y the figures can be arranged in the tracks of the Show Editor by drag and drop with the mouse Nevertheless they have to be assigned to keys in advance Meanwhile there are several ways for the assignment of figures to keys 1 Manual Assignment To assign a figure to a key of the PC or the MIDI keyboard it has to be selected by clicking its icon in the Figure Table Fig 17 Then the button Assign Figure has to be pushed A message will be displayed until a key was pushed If the key has already been chosen for another figure then a warning is displayed The assignment can be started by a click with the right mouse key on the desired figure too do not click the yellow popup window The currently selected figure is shown in the painting window It can also be recognized within the table by its red surrounding square ENEIT LD D O Show E ditor EES l Laser n Delete figure Assign figure lt Delete assigns Complete Reset Attach figure to DMX makro 2 Assignment by drag and drop to the Live Window This way is perhaps the easier one because here the free possibilities for further assignments are easy to identify To do the assignment in this way open the Live Window Fig 18 opened via click the light blue button in the Figure Editor shown in Fig 17 Now it is easy possible to assign a figure to a key just by drag and drop it from the Figure Table to a free place within the Live Window es e JIMU f
252. ziers Please read the respective chapter in the Main Part for more information Tools like Ellipse Rectangle Polygon and Freehand are usually used by the operation click the left mouse button at center position hold it down pull the figure move mouse release the mouse button The handling of the Bezier tool is more complex Generally two control lines are created these lines define the resulting Bezier curve see respective chapter for more explanations The desired painting color is easily chosen by clicking the color palette below the cube or circle Here you will find the 20 brightest colors Brightest because always at least one laser is set to maximum intensity Furthermore you have the possibility to choose the desired color by clicking the color cube or color circle respectively The view of the color selection can be altered via Options Others The display of the cube can be changed by clicking one of the three radio buttons The depth of the cube can be selected by the scrollbar With that you can choose darker grayish colors You can pull other favorite colors into the color palette by drag and drop By use of the function HAND ful points can be marked and with pressed right mouse button shifted to another place too To mark points of the figure pull open a marking square by the use of the left mouse key To mark additional points hold 21 161 00066470 DOC Version 1 0 EUROLIT
Download Pdf Manuals
Related Search
Related Contents
Doro Secure 347 Patient Infusion Pattern based Access Control Schemes for Wireless Clikar guía rápida de programación TH MT2 LABVIEW LIBRARY USER MANUAL Installation manual Model: Skoda Fabia Brother MFC-9840CDW Röhm LTS Zentraldisplay Bedienungsanleitung Katalog 2014 lcd3215-manuel-utili.. Copyright © All rights reserved.
Failed to retrieve file